KEGG   Clostridium acetobutylicum EA 2018: CEA_G0528Help
Entry
CEA_G0528         CDS       T01864                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
cay00010  Glycolysis / Gluconeogenesis
cay00030  Pentose phosphate pathway
cay00051  Fructose and mannose metabolism
cay00052  Galactose metabolism
cay00680  Methane metabolism
cay01100  Metabolic pathways
cay01110  Biosynthesis of secondary metabolites
cay01120  Microbial metabolism in diverse environments
cay01130  Biosynthesis of antibiotics
cay01200  Carbon metabolism
cay01230  Biosynthesis of amino acids
cay03018  RNA degradation
Module
cay_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cay_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:cay00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CEA_G0528 (pfkA)
   00030 Pentose phosphate pathway
    CEA_G0528 (pfkA)
   00051 Fructose and mannose metabolism
    CEA_G0528 (pfkA)
   00052 Galactose metabolism
    CEA_G0528 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CEA_G0528 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CEA_G0528 (pfkA)
Enzymes [BR:cay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CEA_G0528 (pfkA)
Protein phosphatases and associated proteins [BR:cay01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CEA_G0528 (pfkA)
Messenger RNA biogenesis [BR:cay03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CEA_G0528 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ADZ19567
Position
595839..596798
Genome map
AA seq 319 aa AA seqDB search
MKTIAVLTSGGDAPGMNAAIRAVVRTAIEKGINVKGIQRGYSGLINGEIFDMNRHSVSDI
IQRGGTILRTARCPEFLKEEVRQKAANVLRVFGIDGLVVIGGNGSFMGAQKLSKLGVKTV
GLPGTIDNDLPYTDYTIGFDTTLNTVLDAINKLRDTSTSHERVSIIEVMGRDCGDIALFS
GIAGGAESVIIPEIGYDFNELCKNILEGKLRGKMHNLIILAEGVGGAAELAKKVEEVTGI
ETRSTILGHIQRGGSPSAFDRMLASRMGVKAVEVLMEGKTSRVIGIKEGKIMDQDIDEAL
AVPRSFNKELYDIANMLSK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaatagctgttttaacgagtggtggagatgcaccaggtatgaatgctgctata
agagcggtagtaagaactgccattgaaaagggtattaatgttaagggcatacaaagaggg
tacagtggccttataaatggcgaaatatttgatatgaatagacacagcgtatcagatata
atacaacgaggaggcactattttaagaacagcacgttgtccagaatttcttaaagaagaa
gttagacaaaaggcagcaaatgttttaagggtttttggtatagatggtctcgttgtaata
ggtggaaatggttcttttatgggagcacaaaagctttctaagcttggagtaaagacggtt
ggacttccgggaacaatcgataatgatcttccatatacagattacaccataggttttgat
actacacttaatactgtattagacgcaattaataaacttagagatacttctacttctcat
gaaagagtaagtataatcgaggttatgggaagagattgcggtgatatagctctgttttct
ggaatagctggaggagcagaaagtgtaataatacctgaaattggttatgattttaatgag
ctttgtaaaaacatcttagaaggaaaattaagaggaaaaatgcataatcttataatactt
gcagaaggtgttggaggagcagctgagcttgcaaaaaaagttgaagaagttactggtata
gaaaccagatccacaatacttggtcatattcaaagaggaggaagtccatcagcctttgat
agaatgcttgcatctagaatgggagtaaaggctgtagaagtcttaatggaaggaaaaacc
tctagagttataggtattaaagaaggaaaaataatggatcaagatattgatgaggcttta
gcagttccaagaagttttaataaagagttatatgatatagcaaatatgctttcaaaatag

DBGET integrated database retrieval system