KEGG   Clostridium acetobutylicum EA 2018: CEA_G0684Help
Entry
CEA_G0684         CDS       T01864                                 

Definition
bifunctional threonyl-tRNA synthetase/uridine kinase
Orthology
K00876  
uridine kinase [EC:2.7.1.48]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cay00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CEA_G0684
Enzymes [BR:cay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine kinase
     CEA_G0684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
779357..781018
Genome map
AA seq 553 aa AA seqDB search
MSSIEIKLKDGRSFKVNRGTSFHDFINQNKLEGAETAMLGSVNGNIYELTHKFSYSGIFD
IIDLKNPIGIKVYERTLQFVLVKAVSDILPNAVVTIEHSINNGIFGEIHKQDGELTEADI
DKIKNRMLEIVKKDLPIKKVTIDKEKAVEIFEKYGMKDKVRLLKYVKVKYLKLYELDGRY
DYFYGAMAYSTGALKLFDLNYYKPGFILRIPLEKDVDKIPEYRNQTKLYNIFYETEQWGN
ILGVGDVGSLNDKVMKNEIKDIVLISEALHEKKIAYIADMISERKDIKLVLIAGPSSSGK
TTFSKRLGVQLRVNGLMPVAISLDDYFVDRDKTPKDENGNYDFESIEALDVELFNKNLKD
LMEYKETALPKFDFRTGKRIIGTEKIKMPQNGVLIVEGIHGLNEKLTLYIDKKNKFKIYV
SALTQLNLDDHNRISTTDVRKIRRIVRDYLSRGYGGEETLKMWPSIKRGEEKNIFVFQEE
ADVMFNSTLVYELGILRKYALLELSKIKPSSSVYYEARKLRNFLNFFKDIDEKLVPQNSI
LKEFIGGSCFYDY
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
ttgagcagtattgagattaagttaaaggacggtagaagctttaaggttaatagaggaacg
agtttccacgattttataaatcaaaataaactagaaggcgctgagacagcaatgcttgga
agcgtaaacggaaatatatatgagcttacacataaattcagttactcaggaatttttgat
ataatagatttaaaaaatccaataggtattaaggtgtatgaaaggacattacaatttgta
ctagtaaaagcggtttctgatattttacctaatgcagttgttactatagagcattccata
aataatggtatatttggtgaaatacacaaacaggatggggaattgacagaagctgatata
gataaaataaagaatagaatgcttgaaatagttaaaaaagatcttcctataaaaaaggtt
acaatagataaagaaaaagcagttgaaatttttgaaaagtacggtatgaaagataaggta
aggcttttaaagtatgtaaaagttaaatatcttaagctttacgaattggatggaagatat
gattatttttatggtgctatggcatattctactggcgcacttaaactatttgatttaaat
tactataagcctggttttatacttagaattccattagaaaaggatgtagataaaatacca
gagtaccgaaatcaaactaagctttataatatattctatgaaacagaacaatggggaaat
attctaggtgttggtgatgttggatctttaaatgataaggttatgaaaaatgaaattaag
gatatagtattaatttcagaagcactccatgagaagaaaatagcatatatagctgatatg
atatccgaaagaaaagatataaagctagttcttatagcgggaccatcgtcttcaggaaaa
actacattttctaagagattaggagtgcagctgagagtaaatggtttaatgcctgtggct
atttcattagatgactattttgtagacagggataagacaccaaaagacgaaaatggaaac
tatgattttgaatctatagaggcacttgatgtagaactgtttaataaaaatttaaaggat
ttgatggaatataaagaaacagcacttcctaagtttgattttagaactggtaaaagaatt
attggaactgaaaaaataaagatgcctcaaaatggtgtgctaatagtggaaggaatacat
ggattaaatgagaagctgacactatatatagataaaaaaaataagtttaaaatatatgta
agtgcactaacacaattaaaccttgatgatcataacagaatttcaacaacagatgtacga
aagataagaagaattgttagagattacctttcacgtggatatggaggagaggaaacactt
aagatgtggccgtctataaaaagaggagaggaaaaaaatatatttgtatttcaggaagaa
gcagatgttatgtttaactcaacgcttgtgtatgagcttggaatacttagaaaatatgca
ttacttgagctgtcaaaaataaagccttcaagtagcgtatattatgaagcaagaaaactt
agaaattttcttaacttttttaaagatatagatgaaaaattggttccacaaaattcaata
ttaaaggaatttatagggggcagttgtttttacgattattag

DBGET integrated database retrieval system