KEGG   Clostridium acetobutylicum EA 2018: CEA_G0722Help
Entry
CEA_G0722         CDS       T01864                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
cay00010  Glycolysis / Gluconeogenesis
cay00051  Fructose and mannose metabolism
cay00562  Inositol phosphate metabolism
cay01100  Metabolic pathways
cay01110  Biosynthesis of secondary metabolites
cay01120  Microbial metabolism in diverse environments
cay01130  Biosynthesis of antibiotics
cay01200  Carbon metabolism
cay01230  Biosynthesis of amino acids
Module
cay_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cay_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cay00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CEA_G0722 (tpiA)
   00051 Fructose and mannose metabolism
    CEA_G0722 (tpiA)
   00562 Inositol phosphate metabolism
    CEA_G0722 (tpiA)
Enzymes [BR:cay01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CEA_G0722 (tpiA)
Exosome [BR:cay04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CEA_G0722 (tpiA)
  Exosomal proteins of bladder cancer cells
   CEA_G0722 (tpiA)
  Exosomal proteins of melanoma cells
   CEA_G0722 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADZ19761
Position
823356..824102
Genome map
AA seq 248 aa AA seqDB search
MRTPIIAGNWKMNNTISESLKLIEELKPLVKDAKAEVVVAPTAVSLETVVNATKGSNIKV
AAQNAHFEESGAFTGEISLKALEELGVSYVILGHSERRQYFNETDCALNKKVKAAFAHNI
TPILCCGETLEEREANVTNEVTGKQIKLDLAGLSAEQAAKVVIAYEPIWAIGTGKTATDE
QANETIGAIRKTVEVMFGKEVAEKVRIQYGGSVKPNTIKAQMAKPEIDGALVGGASLKAA
DFAAIVNF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaccaataatcgccggtaattggaaaatgaataacacaattagtgaatcttta
aaattaattgaagaattaaagccacttgtaaaagatgcaaaggctgaagttgtagtagca
cctacagctgtttctttagaaactgttgttaatgctacaaaaggaagtaacattaaggtt
gctgcacaaaatgcacactttgaagaaagtggagctttcactggagaaatatcactaaaa
gcacttgaagaattaggtgtaagttatgtaatattaggtcatagtgaaagaagacagtat
tttaatgaaacagattgtgctttgaataaaaaagtaaaagcagcatttgctcataatata
actccaatattatgctgcggagaaactcttgaagaaagagaagcaaatgtaacaaatgaa
gttacaggaaagcaaataaagttagatttagcaggattaagtgctgaacaggcagctaag
gttgttatagcttatgaaccaatttgggcaataggaacaggtaaaactgctacagatgaa
caggcaaatgaaacaattggagcaatcagaaaaacagtagaagtaatgttcggaaaagaa
gttgcagaaaaagtaagaatacaatatggtggttctgtcaaaccaaatacaattaaagct
caaatggctaagccagaaatagatggagcattagttggaggagcaagccttaaagcagct
gattttgcagcaatagttaatttctaa

DBGET integrated database retrieval system