KEGG   Clostridium acetobutylicum EA 2018: CEA_G1010Help
Entry
CEA_G1010         CDS       T01864                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
cay00260  Glycine, serine and threonine metabolism
cay00750  Vitamin B6 metabolism
cay01100  Metabolic pathways
cay01110  Biosynthesis of secondary metabolites
cay01120  Microbial metabolism in diverse environments
cay01230  Biosynthesis of amino acids
Module
cay_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cay00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CEA_G1010 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CEA_G1010 (thrC)
Enzymes [BR:cay01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CEA_G1010 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ADZ20049
Position
1142694..1144184
Genome map
AA seq 496 aa AA seqDB search
MNHIYYKSTRNNDVSILASRAILKGISDDGGLYVPERVPELDFDIKDIVNMDYKEIAYKV
MKTFFTDFTEEELKYCIENAYDSKFDTEEIAPIKKAGDTYFLELYHGPTLAFKDMALSIL
PYLLKTASKKNGIQDKIVILTATSGDTGKAALEGFKDVEGTEIIVFFPNDGVSEVQRLQM
VTQKGKNTHVVAIRGNFDDAQSGVKKIFTDKEFIQELKENNCVFSSANSINIGRLVPQIV
YYFYAYSKMCSKGEINFGEKINFVVPTGNFGNILAAYFAKSMGVPINKLICASNDNKVLY
DFFENGTYDRNREFVTTISPSMDILISSNLERLIYLVCDRDSSKVADFMRELSEGGKYNI
TENMKKKLKDFYAGYATEEETKKAIEKMYKENKYLIDTHTAVAYSVYEKYLKNTKDKAKT
VIASTASPYKFTNAVMTSLDNKYASYDDFELMKKMSEVINKDIPSGVKGLNERKVIHKDI
CSKDEMKKIVRSFLGK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacatatattataaaagtaccagaaataatgatgttagtattttagcgtctaga
gctattttaaagggtatatctgatgatggtggcttgtatgtaccagagagagtaccagag
cttgattttgatattaaagatattgttaatatggattataaagaaatagcttataaagtt
atgaagactttttttaccgattttactgaagaggagctcaagtactgcattgaaaatgcc
tatgacagcaaatttgatacagaagaaatagctcctataaaaaaggcaggagatacatat
tttttagaattatatcatggtcctaccttagcatttaaggatatggcactttcaatttta
ccatatcttttaaaaactgcttcaaagaaaaatggaattcaggataaaatagttatttta
acagcaacatctggcgataccggaaaagcagcattagaaggttttaaggatgttgaaggt
accgagataatagtgtttttcccgaatgatggagtgagtgaagttcaaagacttcaaatg
gtaacacagaaaggaaaaaatacacatgttgtggctataagaggaaactttgatgatgct
caaagcggagttaaaaaaatatttacggacaaagaatttatacaggagcttaaagagaat
aattgtgtattttcatctgcaaactcaattaacataggaagattagttcctcagatagta
tattatttttatgcttattctaagatgtgctcaaaaggtgaaattaattttggagaaaag
ataaattttgttgttcctacaggcaattttggaaatatactagcagcatattttgctaag
agtatgggagtgcctattaataagctaatatgtgcttcaaatgacaataaagttctttat
gatttctttgaaaatggaacttatgatagaaatagagagtttgtaactacaatatcacct
tccatggatattttaatttcaagtaaccttgaaagacttatttatcttgtatgcgataga
gattcaagcaaggtggctgattttatgagagagcttagtgaaggcggaaaatataatata
acagagaatatgaagaaaaaacttaaggatttttatgctggatatgctacagaggaagaa
actaaaaaggctatagaaaaaatgtataaagaaaataaatatcttatagacactcatacg
gctgtagcttatagtgtgtatgaaaaatatttaaagaatacgaaggataaagcaaaaact
gttatagcgtcaactgcaagtccatacaaatttacaaatgcagttatgacctctcttgat
aataaatatgcttcttacgacgattttgaactcatgaagaagatgagtgaggttataaat
aaggatataccaagtggtgttaaaggacttaatgaaagaaaagttattcataaagatatt
tgtagtaaagatgaaatgaaaaaaatagttagaagttttttaggtaagtag

DBGET integrated database retrieval system