KEGG   Clostridium acetobutylicum EA 2018: CEA_G1010Help
Entry
CEA_G1010         CDS       T01864                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cay01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cay00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:cay00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1142694..1144184
Genome map
AA seq 496 aa AA seqDB search
MNHIYYKSTRNNDVSILASRAILKGISDDGGLYVPERVPELDFDIKDIVNMDYKEIAYKV
MKTFFTDFTEEELKYCIENAYDSKFDTEEIAPIKKAGDTYFLELYHGPTLAFKDMALSIL
PYLLKTASKKNGIQDKIVILTATSGDTGKAALEGFKDVEGTEIIVFFPNDGVSEVQRLQM
VTQKGKNTHVVAIRGNFDDAQSGVKKIFTDKEFIQELKENNCVFSSANSINIGRLVPQIV
YYFYAYSKMCSKGEINFGEKINFVVPTGNFGNILAAYFAKSMGVPINKLICASNDNKVLY
DFFENGTYDRNREFVTTISPSMDILISSNLERLIYLVCDRDSSKVADFMRELSEGGKYNI
TENMKKKLKDFYAGYATEEETKKAIEKMYKENKYLIDTHTAVAYSVYEKYLKNTKDKAKT
VIASTASPYKFTNAVMTSLDNKYASYDDFELMKKMSEVINKDIPSGVKGLNERKVIHKDI
CSKDEMKKIVRSFLGK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacatatattataaaagtaccagaaataatgatgttagtattttagcgtctaga
gctattttaaagggtatatctgatgatggtggcttgtatgtaccagagagagtaccagag
cttgattttgatattaaagatattgttaatatggattataaagaaatagcttataaagtt
atgaagactttttttaccgattttactgaagaggagctcaagtactgcattgaaaatgcc
tatgacagcaaatttgatacagaagaaatagctcctataaaaaaggcaggagatacatat
tttttagaattatatcatggtcctaccttagcatttaaggatatggcactttcaatttta
ccatatcttttaaaaactgcttcaaagaaaaatggaattcaggataaaatagttatttta
acagcaacatctggcgataccggaaaagcagcattagaaggttttaaggatgttgaaggt
accgagataatagtgtttttcccgaatgatggagtgagtgaagttcaaagacttcaaatg
gtaacacagaaaggaaaaaatacacatgttgtggctataagaggaaactttgatgatgct
caaagcggagttaaaaaaatatttacggacaaagaatttatacaggagcttaaagagaat
aattgtgtattttcatctgcaaactcaattaacataggaagattagttcctcagatagta
tattatttttatgcttattctaagatgtgctcaaaaggtgaaattaattttggagaaaag
ataaattttgttgttcctacaggcaattttggaaatatactagcagcatattttgctaag
agtatgggagtgcctattaataagctaatatgtgcttcaaatgacaataaagttctttat
gatttctttgaaaatggaacttatgatagaaatagagagtttgtaactacaatatcacct
tccatggatattttaatttcaagtaaccttgaaagacttatttatcttgtatgcgataga
gattcaagcaaggtggctgattttatgagagagcttagtgaaggcggaaaatataatata
acagagaatatgaagaaaaaacttaaggatttttatgctggatatgctacagaggaagaa
actaaaaaggctatagaaaaaatgtataaagaaaataaatatcttatagacactcatacg
gctgtagcttatagtgtgtatgaaaaatatttaaagaatacgaaggataaagcaaaaact
gttatagcgtcaactgcaagtccatacaaatttacaaatgcagttatgacctctcttgat
aataaatatgcttcttacgacgattttgaactcatgaagaagatgagtgaggttataaat
aaggatataccaagtggtgttaaaggacttaatgaaagaaaagttattcataaagatatt
tgtagtaaagatgaaatgaaaaaaatagttagaagttttttaggtaagtag

DBGET integrated database retrieval system