KEGG   Clostridium acetobutylicum EA 2018: CEA_G1066Help
Entry
CEA_G1066         CDS       T01864                                 

Definition
Arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cay00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CEA_G1066
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CEA_G1066
Enzymes [BR:cay01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     CEA_G1066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1207313..1208212)
Genome map
AA seq 299 aa AA seqDB search
MNIDILGVPIYYGSDRKGVDLGPSKLREKNLASLIAKYNHNVKDMGDVNVPFISEKDKFK
FNDKMKFLKPIVEANTELANKVYESLSSGNFPFVVGGDHSLGLGSITGASKALDNLAVIW
IDAHTDINTDKTTETGNVHGMPLSAAMGIGASELTNICYNGQKVKPENVFIIGARSIDKG
ELALIYEKNLTFYSTKTVKRLGVEYILKEITEKLSKNNINSVHLSFDIDCLDETIVPGTG
TPVSDGLNVDDTKLMVESLVKSGLVKSMDLVEFNPALDKDHQTEDLVMEFIDCIFKNLK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaacattgatatattaggcgtacctatctactatggttctgatagaaaaggagtagat
ttaggtcccagcaagttgagagaaaaaaatttagcgtcacttatagccaagtacaatcac
aatgttaaagatatgggcgatgttaatgtaccatttatatccgaaaaggataaatttaaa
ttcaatgataaaatgaaatttttaaagcccatagttgaagcgaatacagaactcgcaaac
aaggtttatgaatcactatcctccggaaactttccatttgtagtaggaggtgaccattca
ctcggtcttggcagcataacgggtgcaagtaaagctcttgataaccttgcagtaatatgg
attgacgctcacacagatataaacacagacaaaaccacagaaacaggtaatgttcacgga
atgcctttatctgctgcaatgggtattggtgcaagcgaacttacaaacatatgctataac
ggtcaaaaagtgaaaccagaaaatgtgttcataataggagcaagatcaattgataagggt
gaattagctctaatttatgaaaaaaaccttaccttctattcaacaaaaaccgtaaagaga
ttaggtgttgagtatattctcaaagagattaccgaaaagctttcaaaaaataatatcaat
tcagttcatctaagttttgatatagattgtcttgatgaaaccatagtaccaggaacagga
acaccggtttctgatggtctaaatgtagacgatactaaactaatggtagaatctcttgtt
aaaagcggtcttgttaagtccatggatcttgttgaatttaatccagctttggataaagat
catcaaactgaagatttagttatggagtttattgactgtatttttaaaaacttaaagtag

DBGET integrated database retrieval system