KEGG   Clostridium acetobutylicum EA 2018: CEA_G1335Help
Entry
CEA_G1335         CDS       T01864                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cay00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1460837..1462333
Genome map
AA seq 498 aa AA seqDB search
MKKYIIALDQGTTSSRAIIFDHEQNILEISQKEFTQIYPSKGWVEHNPLEIWSSQYGVLQ
EVMAKANITQENIAAIGITNQRETTIVWDKNTGEPVYNAIVWQCRRTADIVEGLKRDKEF
SDYVKENTGLILDAYFSATKIKWILDNVEGAREKAEKGELLFGTVDTWLVWKLTNGKVHV
TDYTNASRTMLYNIKELKWDERILRKLNIPRSMLPEVKNSSEVYGYTNLGGKGGIRVPIA
GMAGDQQCALFGQTCFEEGSVKNTYGTGCFLLMNTGENIIQSKNGLVTTIAIGLEGKVQY
ALEGSVFVGGAVIQWIRDELKLVSDAADTEYFAKKVNDNGGVYVVPAFTGLGAPYWDMYA
RGAIFGLTRGANKNHIIRAALEAIAYQSRDLIDAMKEDSGCEITRIKVDGGASRNNLLMQ
FQADITGTEVVRPIITETTALGAAYLAGLAVGFWKSKEEIAEKWSVSEVYTPNLDEDEKI
RLYNGWKRAVERVQGWEE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatatataatagcattagatcaaggaactacaagttcaagagcaataatattt
gaccatgaacaaaatatattagaaattagtcaaaaggaatttactcaaatctatccgagt
aaaggatgggttgagcataatcctttagagatatggtcaagtcaatatggagttttgcaa
gaagtaatggcaaaagctaatataactcaagaaaatattgcagcaataggaattactaat
caaagagaaacaacaattgtttgggacaaaaatactggagaacctgtgtataatgctatt
gtatggcagtgtagaagaacagcagatatagtggaaggacttaagagagataaagagttt
tcagattatgtaaaagaaaatacaggattaatattagatgcatatttttcagcaacaaaa
ataaagtggatattagataatgtagagggtgcaagagaaaaagctgaaaaaggtgaattg
ctatttggtacagttgatacttggcttgtatggaagctaacaaatggcaaagtccatgta
accgattacacaaatgcatctagaactatgctttataatataaaggaattaaaatgggat
gaaagaattttaagaaaacttaatattccaagatcaatgctaccagaagttaaaaattca
tccgaagtttatggatatacaaaccttggaggtaaaggtggtattagagtaccaatagca
ggcatggcaggagatcaacaatgtgcattatttggtcaaacctgttttgaagaaggtagt
gttaaaaatacttatggcacaggatgctttttacttatgaatacaggagaaaatataatt
cagagtaaaaatggactagtaacgacaattgcaattggattagaagggaaagttcaatat
gcattagaaggttcagtgtttgttgggggggcagttattcagtggattagagatgaactt
aagttagttagcgatgctgcggatacagagtattttgctaaaaaagtgaatgacaatggt
ggagtatatgtggtaccagcatttactggtcttggagctccatattgggatatgtatgct
agaggagcaatttttggtctgacaagaggcgcaaataaaaaccatataattagagcggca
cttgaagctattgcatatcagtcaagagatcttatagatgcaatgaaagaagattcggga
tgtgaaattacaagaattaaagttgatggaggagctagtagaaataatttattaatgcag
tttcaagcagacattacaggaacagaagttgtaagacctataataactgaaacaacagca
cttggtgcagcttatttagccggacttgctgtaggcttttggaagtcaaaagaagaaatt
gccgagaagtggtctgtgagtgaggtgtatactccgaatttagatgaggatgagaaaata
agattatataacggttggaagagagcagttgaaagagttcagggctgggaagaataa

DBGET integrated database retrieval system