KEGG   Clostridium acetobutylicum EA 2018: CEA_G1424Help
Entry
CEA_G1424         CDS       T01864                                 

Definition
Phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cay00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1552670..1554103
Genome map
AA seq 477 aa AA seqDB search
MSKGFSKEFLWGGATAANQCEGAYLEDNKGLSTVDVIPKGKDRFPVGLGKMKMLECDSEH
YYPSHEAIDFYHRYKEDIALFHEMGFKCFRLSLAWSRIFPNGDDEIPNEEGLKFYDAVFD
ECLKYGIEPLVTITHFDVPVNLVKTVGSWRSSKMVEYYEKLCKVIFSRYKNKVKYWLTFN
EINMLLHLPFIGAGLVFEEGENEEAIKYQAAHHQLIASAKATKIAREINPNFKIGCMLAA
GNNYANTCAPEDVWRSIEKDRENYFFIDVQSRGEYPNYAKKMLKRKGIELQVEDEDAGIL
KNNTVDFISFSYYSSRLTSANPNINGNTEGNVFATLKNPYLKASEWGWQIDPLGLRITLN
SLYDRYQKPLFIVENGLGAVDTPDENGYVEDDYRIEYLREHIKAMRDAVNVDGVELMGYT
PWGCIDLVSASTGEMKKRYGFIYVDKDNDGNGTLKRSKKKSFYWYKKVIESNGMDIE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaggttttagtaaagaatttttatggggaggcgctacggcggctaatcagtgt
gaaggtgcttatttagaggataataaagggttatctacagttgatgtaattccaaaggga
aaggaccgttttcccgtaggcttaggaaaaatgaaaatgcttgagtgtgacagtgaacat
tattatccaagtcatgaggctattgatttttatcacagatataaagaagatatagctcta
tttcatgaaatgggctttaaatgttttagattatctcttgcttggtcacgaatatttcca
aatggggacgatgaaataccaaatgaggagggattgaaattttacgatgcggtatttgat
gaatgtttaaaatacggaatagaaccattagttactataactcattttgatgttccggtg
aatttagtgaaaacagtaggttcctggagaagcagtaaaatggtagagtattacgaaaaa
ctgtgtaaggttatatttagtcgttataaaaataaggttaagtactggcttacctttaat
gaaataaatatgctattgcatttaccttttataggtgcaggtttagtttttgaagagggt
gaaaatgaggaagctataaaatatcaagcagcacatcatcagcttattgcaagtgcaaag
gcaacaaaaatagctcgtgaaataaatccaaattttaaaatagggtgtatgctagctgct
ggaaataattatgcaaacacatgtgcaccagaagatgtgtggagatctatagaaaaggat
agagaaaactatttctttattgatgtacaatctcgtggagagtatccaaactatgctaaa
aagatgcttaaaaggaaaggtatagagcttcaagtagaggatgaagatgctggaatttta
aagaataatactgttgattttatatcatttagttactattcttcacgcctaactagtgcc
aatcctaatataaatggaaatactgaaggaaatgtctttgctaccttgaaaaatccttat
ctaaaagccagtgaatggggatggcaaatagatccgcttggacttcgaattacattaaat
tctttatacgatcgttatcaaaaaccattatttatagttgaaaatggtttgggagccgtt
gatactccagatgaaaatggatatgtagaagatgactatcgaattgagtatttaagagag
cacattaaggctatgagagatgcagttaatgttgatggtgtagaacttatgggatacaca
ccttggggatgtatagatttagtaagtgcttcaactggagaaatgaaaaagagatatggc
tttatatatgttgataaggataatgatgggaatggaacattaaagcgttctaagaaaaag
agtttttattggtataagaaggtaatagaatcaaatggtatggatatagagtaa

DBGET integrated database retrieval system