KEGG   Clostridium acetobutylicum EA 2018: CEA_G1564Help
Entry
CEA_G1564         CDS       T01864                                 

Gene name
bsaA
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:cay00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cay00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1692154..1692699
Genome map
AA seq 181 aa AA seqDB search
MSVYDFKAKTIEGKEVSLDTYKGKVLIIANTASKCGFTPQYEGLEKLYKEYKDKGLEILG
FPSNQFAEQEPGDNNEVKNFCKLNYGVTFQLFEKTDVRDENAHPLFNYLTENAPFKGFDL
NHPTGKMLSEVLEKNFPKFLEGNSVKWNFTKFLIDRDGNVVKRFEPTSEPSDMVKDIEKL
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtatatgattttaaagcaaaaacaatagaaggaaaagaggtatctttagatact
tataagggaaaggttttaataatagcaaatactgcaagtaaatgcggatttacaccacaa
tatgagggacttgaaaagctgtataaagaatacaaagataaggggctcgaaatattaggc
ttcccaagtaatcaatttgcagaacaggaaccaggagataataatgaagtaaagaatttt
tgcaaacttaattatggagtaacctttcaactatttgaaaaaacagatgtaagagatgaa
aatgcacatcctttatttaactacttaactgagaatgctccatttaagggatttgattta
aatcatccaacaggaaaaatgctttcagaggttttagagaagaattttccaaagttctta
gaaggaaattcagtaaaatggaactttacaaagtttttaatagatagagatggaaatgtt
gtaaaaagatttgaaccaacttctgaaccaagtgatatggttaaagatatagaaaagtta
ttataa

DBGET integrated database retrieval system