KEGG   Clostridium acetobutylicum EA 2018: CEA_G1587Help
Entry
CEA_G1587         CDS       T01864                                 

Definition
Fructose-1,6-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cay01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cay00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cay00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cay00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:cay00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1715473..1717470
Genome map
AA seq 665 aa AA seqDB search
MLLESNTKNEEIKDNLKYLVLLSKQYPTINEAATEIINLQAILNLPKGTEHFLSDVHGEY
EQFIHVLKNASGVIKRKIDDIFGNRLMQSEKKSLATLIYYPEQKLDIILKQEKNIDDWYK
ITLYRLIEVCRNVSSKYTRSKVRKALPKEFSYIIEELLHEQPKGVDKQEYYDEIIKTIIS
IDRAKEFITAISKLIQRLVVDRLHIIGDIFDRGPRADIIMDKLEEYHAVDIQWGNHDILW
MGAASGSSVCMANVIRISARYANLSTIEDGYGINLLPLATFAMDFYGNDKCKNFEPKIES
DKSYTVKEIELIGKMHKAIAIIQFKLEGEAIKRHPEFKMEHRMLLNKINFEDSTIELDGK
KYKLNDTSFPTIDKNDPYKLIDEEREVVEKLRSSFVNSEKLNRHVRFLFSHGNLYLKFNS
NLLYHGCIPLNEDGTFKEVLIGSHKYKGKALLDKLDVLARKSFFYEENSKNSKYENDMIW
YLWSGPFSPLFGKEKMTTFERYFIDDKKTHYEKKDPYYHYRDDEDICINILREFGLDSEQ
AHIINGHVPVESKNGENPIKANGKLIVIDGGFSKAYQSKTGIAGYTLIYNSFGLQLVSHE
LFETTEKAIKEETDIISSTVIFEKSVRRKRVGDTDIGKDLKKQLYELNLLLLAYKKGLIK
EFVKS
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgctattagaaagtaacaccaaaaacgaagaaattaaggacaatttaaagtacttagtt
cttctttcgaaacagtacccaacaattaacgaagcagctacggaaataatcaatctacag
gctattttaaacctacctaaaggaacggaacactttttatcagatgttcatggggaatat
gaacaattcatacatgtacttaagaacgcctctggagtaataaaaagaaaaatagacgat
attttcggaaatagacttatgcagagtgaaaagaaaagtcttgctacgttgatttattat
ccggagcagaagctggatataatattaaagcaggaaaaaaatattgatgactggtataaa
ataacactgtataggcttatagaggtttgcaggaatgtctcctcaaagtatactcgttct
aaagtaagaaaagctcttcctaaagaattttcgtatataattgaggagcttttgcatgaa
caacccaagggagtagataagcaggaatattatgacgagataataaagactattataagc
atagatagggctaaggagtttataactgcaatatcaaagcttatacagaggcttgtagta
gatagacttcacataataggtgatatctttgatagaggtccaagggcggatattataatg
gataagcttgaagagtatcatgcggtagatattcaatggggaaatcatgatattttatgg
atgggagctgcatccggttcttcagtatgcatggcaaatgtaataagaatttctgcaaga
tatgcaaatctgtcaactatagaagatggttacggaattaatttgttgccattagccact
tttgctatggacttttacggaaacgataagtgcaagaattttgaacctaagatagaatct
gataaaagttatacagtcaaggaaattgaacttataggtaaaatgcataaggctattgcg
ataatacagtttaagcttgaaggagaagctataaaaagacatcctgagtttaagatggaa
cataggatgcttctaaacaaaatcaactttgaagacagtaccatagaattggatggtaaa
aagtataaattaaatgatacaagctttccaactatagataaaaatgatccatataaactt
atagatgaggagagggaggtagttgaaaaattaagatcttcatttgtaaatagtgagaaa
ctaaacaggcatgtaaggtttttattttctcatggaaatctgtacctaaaatttaactct
aatttgttataccatggctgtatacctttaaatgaggacggaacctttaaagaggtgtta
ataggaagtcataagtataagggaaaggcacttttagataaacttgatgttttagctaga
aaaagctttttttatgaagaaaattctaaaaacagtaagtatgagaatgatatgatatgg
tatctttggtcaggccctttttcgccactttttggtaaagaaaaaatgacaacatttgaa
agatattttattgacgataagaagacacattatgaaaagaaagacccatattatcattac
agagatgatgaagatatatgtatcaatattttaagggaatttggacttgattctgagcaa
gctcatattataaatgggcatgttcctgtagaaagtaaaaatggagaaaatccaataaag
gcaaatgggaaattaatagttattgatggagggttttcaaaggcatatcaaagtaaaact
ggaatcgctggatataccttaatatataactcttttggacttcaacttgtatcacatgaa
ctgtttgaaacaactgaaaaagcaataaaagaagaaacagatataatatcttctactgtt
atatttgaaaaatcggtaagaagaaaaagagtaggagatactgatatagggaaagatttg
aaaaagcagctctatgagttgaacctattgcttttagcttataagaaggggcttattaag
gaatttgtaaaaagttaa

DBGET integrated database retrieval system