KEGG   Clostridium acetobutylicum EA 2018: CEA_G2143Help
Entry
CEA_G2143         CDS       T01864                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cay00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    CEA_G2143
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CEA_G2143
Enzymes [BR:cay01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     CEA_G2143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2218372..2219820)
Genome map
AA seq 482 aa AA seqDB search
MKLKKIIGDVKYELICGDLNVEIDNLNYDSRKVNEKGLFFCIEGYTSDGHDFIDKAVEKG
ADVIVCTKVPKKLPNCTVVKVEDGRKAMAVMGANFYDNPSHKLKLIGITGTNGKTTSTYM
MKSMLESSGYKVGLIGTIANYIGDKKIESHRTTPESLELQKLFSDMVHDKIDYCVMEVSS
HSLYLDRVYGIVFEEGIFTNLTQDHLDFHKTFENYYKAKMILFKNSKRSIINIDDKYGER
VFKDAGNDKITYGLTEKADLKAENLKMTSRGTEFDLCYRGLREHVKINIPGKYNVYNALG
SVAACLNEGISIEKVKDGLNKLSSVPGRCEIVTHNTNLDFDVVLDYAHTPDGLEKVLKAS
REFTKGRLISVFGCGGDRDKTKRPIMGEIGSKLSDIAVITSDNPRSENPEEIIKDIVQGI
KTDNYVIVENRKEAIKKAMLMAKKDDVIVLAGKGHENYQILGDKTIHFDEKEIVSEFIKE
LF
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgaaaaaaataattggtgatgtgaaatatgaacttatatgtggagatttgaac
gtagaaattgataatttaaattacgattcgagaaaagttaatgaaaagggattatttttt
tgtattgaaggatatacaagtgatggacatgattttatagataaggcggtagaaaaaggc
gctgatgttatagtatgtactaaggttcctaaaaagcttcctaattgtactgtagttaag
gttgaggatggaagaaaggcaatggctgttatgggggccaatttttatgataatccatct
cataagttaaagcttataggcattactggaaccaatggtaaaacaacttctacatatatg
atgaaatctatgcttgaaagctcgggatataaggttgggcttataggtactatagcaaac
tacataggagataaaaaaatagaaagtcatagaacaactccagaatcattagagcttcaa
aaattatttagtgatatggtacatgataaaatagattattgtgttatggaggtgtcatca
cattcattatatcttgacagagtatacggaatcgtctttgaagaaggtatatttacaaat
ttaacacaagatcatttggattttcataaaacctttgaaaattattataaagcaaagatg
atattatttaaaaacagtaaaaggtctataataaatattgatgataaatatggtgaaaga
gttttcaaagatgcaggtaatgataaaataacttacggtcttacagaaaaggctgattta
aaggcggaaaatttaaaaatgacatcaagaggaacagaatttgatttgtgttatagggga
ttaagagagcatgtgaaaataaacattccgggaaagtataatgtatataatgcacttgga
agtgtagctgcatgcttaaatgaaggaataagtatagagaaggtgaaagatggattaaat
aaactttcatcagttcctggaagatgcgaaatagttacccacaatacaaatttggatttt
gatgtggtattagattacgcgcacacacctgatgggcttgaaaaggtacttaaagcttca
agagaattcacaaagggaagacttatttctgtttttggatgtggaggagacagagataaa
actaaaagacctataatgggtgaaataggctcgaagcttagtgatattgcagtaataact
tctgataatcctagaagtgaaaatccagaagaaataataaaggatatagttcaaggtatt
aaaactgataactatgtaatagtagagaatagaaaagaagcaataaaaaaagctatgctt
atggctaaaaaggacgatgttatagttttggctggtaagggccatgaaaattatcaaata
ctaggtgataaaactattcattttgatgaaaaagaaatagtttcagaatttataaaggag
ctgttttaa

DBGET integrated database retrieval system