KEGG   Clostridium acetobutylicum EA 2018: CEA_G2236Help
Entry
CEA_G2236         CDS       T01864                                 

Gene name
cheB
Definition
Chemotaxis protein CheB, (CheY-like receiver domain and methylesterase domain)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:cay02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:cay02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2311976..2313013)
Genome map
AA seq 345 aa AA seqDB search
MEKIKVIVVDDSVLMRRLICDMLESNDNIEVIGTAINGQDLLNKLKVMKPDVITLDIEMP
VMNGIETLKAVKSLKIDIPIIVFSSISQKGMKYTMECLYLGAFDFIPKPEKPFELSKMKD
DLIKRIRVAYSQNTNKNPAPINPVIRRETNRISSDSIEAVVIGASTGGPKALYKVITKFP
KDMNVPVFVVQHMPVGFTKAFADRLNDNSAIEVKEATDGETYRKGVVYVAPGGYHMEVDS
NSRIKLTKEPPIWGVRPAVDKLFISASKIFKSHIVSAVLTGMGKDGSNGTGIIKDNGGVT
ISESETTCVIYGMPKAAFETGKVDLVVPIDNVADEIIKIVRGLRR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaataaaagttattgtggtagatgattcagtgcttatgagaagattaatatgt
gacatgttagaaagtaatgataatattgaagttattggtactgcaataaatggacaggat
ttgttaaataagttaaaggttatgaaaccagatgttataactttagatatagaaatgccg
gttatgaatggtattgaaactcttaaagctgttaaatcattaaaaattgacataccgata
atagtgtttagtagtatttctcaaaaagggatgaagtacactatggaatgtctttattta
ggggcctttgattttattccaaagcctgaaaagccatttgaactttctaagatgaaggat
gatctcataaaaagaataagggtagcatatagccaaaatacaaataagaatcctgcacca
attaatcctgttataaggagggaaacaaatcgtataagtagtgatagcatagaagcagta
gttataggagcatctacaggtggacctaaagcattgtataaagttattacaaagtttcct
aaagatatgaatgttccagtatttgttgttcaacatatgcctgttggttttacgaaagct
tttgcagatagacttaatgataatagtgcaatagaagtaaaagaggcaacagatggagag
acttatagaaagggagttgtttatgtagctcctggaggatatcatatggaagtagattca
aattcaagaataaagcttaccaaagaaccgcctatatggggagtaagaccggcagtggat
aaactatttatttctgcttctaaaatttttaaatcccatatagttagtgctgtgttaacg
ggaatgggtaaggatggatctaatggaacaggaattattaaagataacggtggtgtaact
atttcagaatctgaaacaacatgtgttatatatggaatgcctaaagcagcatttgaaact
ggaaaggtggatcttgttgttccaatagataatgtagctgatgagataataaaaatagta
agaggtcttaggaggtag

DBGET integrated database retrieval system