KEGG   Clostridium acetobutylicum EA 2018: CEA_G2260Help
Entry
CEA_G2260         CDS       T01864                                 

Definition
Lysophospholipase L2 PLDB, hydrolase of alpha/beta superfamily
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cay00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CEA_G2260
Enzymes [BR:cay01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CEA_G2260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2339871..2340962)
Genome map
AA seq 363 aa AA seqDB search
MRKLSKKVFLIFAVTTIFILGNSAWDRTIASEEDNSMIDGKPKEYYISEKNYKREIKQVE
NYLSARRESGHFIGKENIDIYYEKYVIPNSKNSIVISHGFRESMVKYNETIYYFLKNGYS
VYGLEHRGHARSGRLGKDSTQTSVDNFDYYVDDFKKYVDTIVEPDNRGKNLFLYAHSMGG
AIGGLFLERYPKYFKAAVLSSPMFEVDTGRYPEFLSRAVASVFNFVNLGDTYAPGHHEYS
CESDFENSCTTSNIRYDYYLDKTNKSRKIENGGASFKWVKESLKATDEVTDGKNASKVTI
PVLLFQAENDDIVRPGGQDKFAKEAKKCKLIVIKNSKHEIYREKDSIMVPYFNKVFTFLN
NNK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagttaagtaagaaggtttttttgatttttgctgtaacaacaatttttattctt
ggaaattcagcttgggataggaccatagcatctgaagaggataattctatgattgatgga
aaacctaaagagtattatataagtgaaaaaaactataaaagagaaataaagcaagttgaa
aattatcttagtgctaggcgagaatcagggcattttattggaaaggaaaatatagatatt
tactacgaaaaatatgttataccaaattcaaagaattcaattgtaatatcccatgggttt
agggagagtatggtaaagtataatgaaacaatatattattttttgaaaaatggatattcc
gtatatggattggaacatagaggccatgcaagatcaggtagattaggaaaagattcaaca
caaacaagtgtagataattttgattattatgtagatgattttaaaaaatatgttgatact
atagtagaaccggataatagagggaaaaatttattcttatatgcacattctatgggagga
gcaattggaggcttatttctagaaaggtatcctaaatatttcaaagccgcagttttaagt
tctccaatgtttgaggtagatacgggaagataccctgaatttttgtcaagagctgttgca
agtgtatttaactttgtgaatttaggagatacatatgctcctggtcaccatgagtattct
tgtgaatcggattttgaaaattcctgcacaacaagtaatattagatatgattattattta
gataaaactaacaagagtagaaaaattgaaaatggtggagcttcgtttaagtgggtaaag
gaatctttaaaggcaacagatgaggttacagacggaaaaaatgcatcaaaagtaactatt
ccagtgttgttatttcaagccgaaaatgatgatatagtaaggccaggaggacaagataag
tttgcaaaagaagctaagaagtgtaaactaatagtgattaagaattcaaagcatgaaata
tatagagaaaaggatagtataatggttccatatttcaataaggtatttacttttcttaat
aacaataagtag

DBGET integrated database retrieval system