KEGG   Clostridium acetobutylicum EA 2018: CEA_G2528Help
Entry
CEA_G2528         CDS       T01864                                 

Definition
Beta galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cay00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CEA_G2528
Enzymes [BR:cay01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CEA_G2528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2620264..2623212)
Genome map
AA seq 982 aa AA seqDB search
MNNNFKKVLMCLLGVGIYISAVTFPSKIYADTIQKKISRNNNDSFTLPSSQGLKGIHNVS
YDHYSLMIDGKRIFLYSGEFDYWRLPSQSGWMDVLEKMKAAGFNAVTIYFNWGFHSPKQG
KYDFSGIRDVDKLLTMAQKIGLYVVARPGPYINAETDGGGYPGWLTTQQGRARTASQDYT
AAYEQWLSAIDPIIEKHQITNGGSVILYQVENEYTGGDALYMQNIRDKARKDGINVPTFH
NDKSGPKGRWSSGTGAPDMYAYDSYPGLAAIPSYYGDPRKFAPNSPVFLAELGGGWFDPW
GGKSYAILSKNYNANYENVLYNHVVSEGATMMSIYMTYGGTNWGYLPFPGVYSSYDYTAA
ISESRQLGSKYNEEKLLATMYRTLTPLTKTDPLTTIEAPSNPNLLANAIENSDTKTQFYI
LRHSNGSSISNDNTTLKIQSADGIYILPQEPGTSININGQESKFIVANFQLGSEHLVYST
SNLYTYVTQGNRDTAIFYGGQESDGETVLRYKNQPKVTVLCGNVKSRYDSVSGDLRLNYK
HDGSISRVMIKDDNKELMLLFTTDITAQTFWCEDTSIGEILVRGPYLVRSASIRDRNKLE
LQGDTDKASDIEVFAPTSVNEIKWNGEKVKALQTSYLSYTFSLLSPEQVLIPVITNWKYS
YETNEAQSEFDDSSWISANKTTTNNPVKPLTPTVLYADDYGFHHGVVWFRGHFKASGKET
GIILDGEGGTNGAYAVWINGFYLGASLSGIKNFTFPKNVLKTSDDNVISVMVQNMGHDED
GGCKDTHKSPRGLVQASLQGDTTSIFWSIQGNKGGETLIDPVRGAMNAGGLYGENNGWTL
PNFPDKPWKQVTLPDNGKQRGVAPGVSWYRTTFKLNFPKMSDVPLALYIKDNNTKNYRAY
IYVNGWLIGQYINSLGPQNLFSLPSGVLDPNGKNTIAIAVWALDNNSTGLGEIILQKLGN
YSGGVPVKMNDNPSYKDVFNKN
NT seq 2949 nt NT seq  +upstreamnt  +downstreamnt
atgaataataattttaaaaaagtacttatgtgtttactcggcgttggtatttatatatca
gcggtaacgttcccttcaaaaatatatgctgatactatacagaagaaaatatcacgcaac
aataatgattcatttactttgccatcatctcaaggattaaaaggaattcataatgtttcg
tatgatcactattcgttgatgattgatggaaaaagaatttttctttattctggtgagttt
gattattggcgtttaccaagtcaatctggctggatggatgttttagaaaaaatgaaagca
gctggttttaatgctgttaccatttactttaactggggttttcattctcctaaacaaggg
aaatacgatttttctggaattcgcgatgttgataaactccttactatggcacaaaagatt
gggttatatgtagttgcaagaccaggtccatatattaatgcagaaactgacggaggagga
tatccaggttggttaacaacacagcagggaagagcgcgtactgcttcacaagattatact
gctgcctatgaacaatggctgagtgctattgatccaattattgaaaagcatcaaattaca
aatggaggaagcgtaattttgtaccaagtggaaaatgagtatacaggtggagatgccttg
tatatgcagaacattagagacaaagcacgtaaggatggaattaatgtaccaacttttcat
aatgacaaaagtgggccaaaaggaagatggtctagtggaactggtgcaccagatatgtat
gcatatgacagttaccctggactagcggcaattccatcatattacggagatccgcgtaaa
tttgcaccaaatagtccagtgtttttagcggaactaggaggtgggtggtttgatccttgg
ggaggaaagagttacgctatactttctaaaaattataatgctaattatgaaaacgtttta
tacaaccatgttgtatctgaaggagcaactatgatgagtatttacatgacttatggtgga
acaaattgggggtatttgccttttccaggtgtgtactcttcctatgattatacagcggca
ataagtgagagccgtcagcttggatcaaagtataatgaagaaaagctacttgcaactatg
tacagaacgcttacccctcttacaaagacagatccattaacaaccatagaagctccaagt
aatcctaatttattagctaatgcaattgaaaattcggatacaaaaactcagttttatata
ctgcgtcatagtaatggttcctcaattagtaatgataatacgactttgaaaattcagagc
gcagatggcatttatatacttccacaagaacctggtacatcaatcaatataaatggacaa
gaatctaaatttatagttgctaattttcaacttgggtcagagcatttagtgtattcaact
tctaatttatatacttatgttacacaaggaaatagagacactgctattttttacggagga
caagaatcggatggtgaaacagttcttcgttataaaaatcaacctaaagtgactgtttta
tgtggaaatgtaaagtcaaggtatgattctgtaagtggagacctacgcttaaattataaa
catgatggaagtatttcacgtgtaatgataaaagatgacaacaaagaattaatgctgctt
tttacaacggatataacggctcaaacgttctggtgtgaagatacttctataggagagatt
ttagttaggggaccttatttggtaagatctgcatcaatacgtgatagaaataaattagaa
ctacaaggtgatactgataaggcatcagatatagaggtatttgctccaacgtctgtcaat
gaaatcaagtggaatggtgaaaaagttaaagcattacaaacttcttatttatcatatact
ttttctctgttatcgccagaacaagtattaattccagttattacaaattggaagtactca
tatgaaactaatgaagcacagtcagaatttgatgattcatcttggataagtgcaaataaa
acaactacaaataatccggtaaagcctttaaccccaactgtattatatgcagatgattat
ggttttcatcacggagttgtttggtttagaggacactttaaggcaagtggaaaagaaaca
ggaattattttagatggagaaggaggaacaaatggagcatatgctgtgtggataaatggt
ttttacttaggtgcttcattaagcggaattaagaattttacatttcctaaaaatgtttta
aaaacaagtgatgacaatgtcatatcagtgatggtacagaacatgggacatgatgaagat
ggtggatgcaaggatacacataaaagcccacgtggacttgtgcaggcatcgcttcaagga
gatacaacatcaattttctggagtattcaaggaaataaggggggagagactttgatagat
cctgttagaggggcaatgaatgcgggtggattatatggtgaaaataatggttggacactg
cctaattttcctgataaaccatggaaacaagtaacactaccagacaatggaaagcaaaga
ggagtagcaccaggagtttcgtggtatagaactacattcaagttgaatttccccaaaatg
agcgatgttccccttgcactttatataaaggataataatactaaaaactatcgtgcttat
atttatgtaaatggatggcttattggtcaatatataaatagtttgggacctcagaattta
ttttcactgccctctggtgtattagatccaaatggtaaaaatactattgctattgcagtt
tgggcattagataataattcaacaggacttggagaaataattttacaaaagcttggtaat
tattcaggtggtgtaccagttaaaatgaatgataatccgagctataaagatgtttttaat
aaaaactaa

DBGET integrated database retrieval system