KEGG   Clostridium acetobutylicum EA 2018: CEA_G2622Help
Entry
CEA_G2622         CDS       T01864                                 

Gene name
glcK
Definition
Transcriptional regulators of NagC/XylR family
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cay00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CEA_G2622 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CEA_G2622 (glcK)
   00052 Galactose metabolism
    CEA_G2622 (glcK)
   00500 Starch and sucrose metabolism
    CEA_G2622 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    CEA_G2622 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CEA_G2622 (glcK)
   00524 Butirosin and neomycin biosynthesis
    CEA_G2622 (glcK)
Enzymes [BR:cay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CEA_G2622 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2716299..2717240)
Genome map
AA seq 313 aa AA seqDB search
MRTYGFGIDIGGTTIKMGLFRVDGTLLDKWEIPTRKEESGKYILSDISKEIKDKMKEKGI
HRNDVIGVGVGVPGPVSSDGTVLKCVNLGCGIFNVEETLSEMIDIPVKAGNDANIAALGE
MWQGGGKGYKNVVMVTLGTGVGGGIIINGNIISGANGAGGEIGHIKVEENEKDVCGCGKT
GCLEQYASANGIVREAKKLLNNSSEPSSLREIKTVTSKDIFDAAKEGDKLANELVEALGK
KLGNALATVSCVSDPEVFVVGGGVSKAGMILINVIQKNFIEKAFHACEGTKFELARLGND
AGIYGGVKLVLEI
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagaacatatggatttggaatagacattgggggaacaacaataaaaatgggtctattc
agagttgatggcactttacttgataagtgggagattcctactagaaaagaggaaagtgga
aagtatatattaagtgatatatcaaaagaaataaaagataagatgaaggaaaaaggaata
catagaaatgatgtaattggtgtaggagttggagtaccaggaccagttagcagcgatgga
accgttttaaaatgtgtgaacttaggatgtggcatatttaatgtagaagaaactttaagt
gaaatgatagatattccagtaaaggctggtaatgatgctaatatagcagctttgggcgaa
atgtggcagggaggaggaaaaggctataaaaatgttgttatggttacacttggaacaggc
gttggcggaggaattataattaacggcaatataatttctggagcaaatggtgcaggtgga
gaaataggccatattaaagtagaggaaaatgagaaagatgtttgtggatgtggaaagaca
ggctgtcttgaacagtatgcctcagcaaatggaattgtaagagaagcaaaaaaactttta
aataatagtagtgaaccttcctctttgagagaaattaaaacggttacttcaaaggatata
tttgatgctgcaaaagaaggagataaattagctaatgaacttgttgaagctttaggaaaa
aaattaggtaatgcattagccacagtttcatgtgttagtgacccagaggtttttgttgta
ggtggaggagtatcaaaggctggaatgattcttataaatgtaattcagaaaaatttcatt
gaaaaggcatttcatgcatgtgaaggaactaagtttgagcttgcaaggcttggaaatgat
gcaggaatttacggcggagtaaaattagtattagagatataa

DBGET integrated database retrieval system