KEGG   Clostridium acetobutylicum EA 2018: CEA_G2622Help
Entry
CEA_G2622         CDS       T01864                                 

Gene name
glcK
Definition
(GenBank) Transcriptional regulators of NagC/XylR family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
cay00010  Glycolysis / Gluconeogenesis
cay00052  Galactose metabolism
cay00500  Starch and sucrose metabolism
cay00520  Amino sugar and nucleotide sugar metabolism
cay00521  Streptomycin biosynthesis
cay01100  Metabolic pathways
cay01110  Biosynthesis of secondary metabolites
cay01120  Microbial metabolism in diverse environments
cay01130  Biosynthesis of antibiotics
cay01200  Carbon metabolism
Module
cay_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cay_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cay00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CEA_G2622 (glcK)
   00052 Galactose metabolism
    CEA_G2622 (glcK)
   00500 Starch and sucrose metabolism
    CEA_G2622 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    CEA_G2622 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CEA_G2622 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CEA_G2622 (glcK)
Enzymes [BR:cay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CEA_G2622 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Pan_kinase
Motif
Other DBs
NCBI-ProteinID: ADZ21659
Position
complement(2716299..2717240)
Genome map
AA seq 313 aa AA seqDB search
MRTYGFGIDIGGTTIKMGLFRVDGTLLDKWEIPTRKEESGKYILSDISKEIKDKMKEKGI
HRNDVIGVGVGVPGPVSSDGTVLKCVNLGCGIFNVEETLSEMIDIPVKAGNDANIAALGE
MWQGGGKGYKNVVMVTLGTGVGGGIIINGNIISGANGAGGEIGHIKVEENEKDVCGCGKT
GCLEQYASANGIVREAKKLLNNSSEPSSLREIKTVTSKDIFDAAKEGDKLANELVEALGK
KLGNALATVSCVSDPEVFVVGGGVSKAGMILINVIQKNFIEKAFHACEGTKFELARLGND
AGIYGGVKLVLEI
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagaacatatggatttggaatagacattgggggaacaacaataaaaatgggtctattc
agagttgatggcactttacttgataagtgggagattcctactagaaaagaggaaagtgga
aagtatatattaagtgatatatcaaaagaaataaaagataagatgaaggaaaaaggaata
catagaaatgatgtaattggtgtaggagttggagtaccaggaccagttagcagcgatgga
accgttttaaaatgtgtgaacttaggatgtggcatatttaatgtagaagaaactttaagt
gaaatgatagatattccagtaaaggctggtaatgatgctaatatagcagctttgggcgaa
atgtggcagggaggaggaaaaggctataaaaatgttgttatggttacacttggaacaggc
gttggcggaggaattataattaacggcaatataatttctggagcaaatggtgcaggtgga
gaaataggccatattaaagtagaggaaaatgagaaagatgtttgtggatgtggaaagaca
ggctgtcttgaacagtatgcctcagcaaatggaattgtaagagaagcaaaaaaactttta
aataatagtagtgaaccttcctctttgagagaaattaaaacggttacttcaaaggatata
tttgatgctgcaaaagaaggagataaattagctaatgaacttgttgaagctttaggaaaa
aaattaggtaatgcattagccacagtttcatgtgttagtgacccagaggtttttgttgta
ggtggaggagtatcaaaggctggaatgattcttataaatgtaattcagaaaaatttcatt
gaaaaggcatttcatgcatgtgaaggaactaagtttgagcttgcaaggcttggaaatgat
gcaggaatttacggcggagtaaaattagtattagagatataa

DBGET integrated database retrieval system