KEGG   Clostridium acetobutylicum EA 2018: CEA_G2732Help
Entry
CEA_G2732         CDS       T01864                                 

Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cay01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cay00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2847572..2848969)
Genome map
AA seq 465 aa AA seqDB search
MDKINEKIDLLKDDMVSSIQEILRIKSISGEAEGNAPFGKDTAKALDYALKLAERLGFKT
VNLDNYVGYAEYGEGEDYVAVLGHLDVVPEGDGWNYPPYAAEIHDGKLYARGSMDDKGPT
VACLYSLKAIVDAGLTMSKKVRIIFGLDEETGSGKDTEHYLKNEKPPVLGFTPDAEYPII
NGEKGITIFNLVKDFKNDYEGDTKIIYVKGGERSNVVPPYAEAGIRADLKGEIIDKCESF
AERTGYDIKAEEKDDMVIVKSKGIAAHGSMPELGKNAIMQLLAFLEELNLGKSDFNDYIA
FLNRYVGMETNGESFGIGMEDKVSGKLSFNLGIIDFNKDQGKVVLNVRYPVTCKYEDMMD
GINARIADTGIRVENMTHQKSLYFPEDHELVKLLQKVYKEQTSEEPKLLSIGGGTYAKEM
PNIVAFGPIFPGEPDVDHQANEFIKIEHLILNAKIYAHAIYELAR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggataagataaacgagaagatagacttattaaaggatgatatggtttcttcaattcaa
gaaatccttagaattaaaagtatcagcggggaagctgaaggaaatgcaccatttggaaag
gatacagcaaaggcacttgactatgctttaaagttagctgaaagacttggtttcaaaact
gttaatttagataactatgttggatatgctgaatatggtgaaggagaagattatgtagca
gtacttggtcaccttgatgtagtgccagaaggagatggatggaattatcctccatatgct
gcagaaatacatgatggaaagctatatgcaagaggatcaatggatgacaagggacctaca
gtagcatgtttatattcattaaaggctattgtggatgcaggacttactatgtctaaaaaa
gttagaattatattcggtttggatgaggaaactggttcaggaaaagatacagagcattat
ttaaagaatgaaaaaccaccagttcttggctttactccagatgctgaatatccaataatc
aatggagaaaaaggaataacaatttttaacttagtaaaagattttaaaaatgattacgaa
ggagatacaaagattatttatgtaaaaggaggagaaagatcaaatgtagttcctccatac
gctgaagctggaataagagcagatttaaagggcgaaatcattgataaatgtgaaagtttc
gctgaaagaactggatatgatataaaagctgaagaaaaagacgatatggttatagtaaaa
tcaaaaggaattgctgcacatggaagtatgccggagcttggaaaaaatgctataatgcag
cttttagcttttctagaagaattaaatcttggaaaatctgattttaatgattatatagct
ttcttaaatagatatgttggaatggaaactaacggagaatcttttggaattggtatggaa
gataaggtttcgggtaagctttccttcaatcttggaataatagactttaataaagaccaa
ggaaaagttgttcttaatgttagatatcctgtaacttgcaaatacgaggatatgatggat
ggaataaatgctaggatagctgatactggaataagagttgaaaacatgacacaccagaag
tcattatactttccagaagatcatgaattagtaaaacttcttcaaaaagtatataaagag
caaactagtgaggagccaaaacttctttcaataggcggaggaacttatgcaaaggaaatg
cctaacatagtagcctttggaccaatattcccaggagaaccagatgttgatcaccaagca
aatgaatttataaaaattgaacatttaatactaaatgcaaaaatatatgctcatgcaata
tatgagcttgctcgttaa

DBGET integrated database retrieval system