KEGG   Clostridium acetobutylicum EA 2018: CEA_G2827Help
Entry
CEA_G2827         CDS       T01864                                 

Gene name
murE
Definition
UDP-N-acetylmuramyl tripeptide synthase, MURE
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cay00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cay00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2946880..2948331
Genome map
AA seq 483 aa AA seqDB search
MKLKQLLQNIDYDLIKGDININIEGISYNSKKVKQNYVFVSIKGARFDGHDFIKEAAQNG
AAAVIIDEDFHDSIENTTLVKVKNSKVALACLCNLFYEEPSRELNLVGVTGTNGKTTVIH
YIRDMLEAFGNSTGTIGTLGYELKDKEINVEKINPTTPEALELNQILRDFIDKGAKNAVM
EVTSSALMKHRVDYCSFKVGVFTNLSQDHLDEHGTIENYKNEKIKLFKMCPVGVINLDDN
IAGEIIEKGTCEFFTYGVLTNADLTASDMVYKPNSVSFNVHYKGISSKVKVNVPGEFTVY
NVLAAIGSLLCLGIDFESILKLVSSIKPVLGRLETINNPLNKNIIIDYAHTPDSLEKLLI
MAREMTNGRIITVFGCGGDRDKSKRGLMGMAVGILSDYCIITSDNPRHEKPEDIIRDIER
GMQTINSSYEKITDRRCAIKRGIEILKEEDILIIAGKGHEDYQIIGDNKVHFDDREVVNE
LLG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaaacaacttttacaaaacatagattacgatttaataaaaggggacattaat
ataaatatagaaggaataagctataattctaaaaaggttaaacaaaattacgtttttgtt
tccattaaaggagcaagatttgacggtcatgatttcataaaagaagctgcacaaaatggg
gctgcggcagttattatagatgaagattttcatgattcaatagagaatacaaccttagta
aaagttaaaaattcaaaagtggctttagcttgcctatgcaatttattttatgaggagccc
tctagagaacttaacttggttggtgtaactggcaccaatggaaaaaccacagttatacat
tacataagagatatgcttgaagcctttggcaatagcactggtactataggaactcttggt
tatgagttaaaggataaagaaataaatgtagaaaaaattaatcctactacgccagaggct
ttagagcttaaccaaattttaagggactttatagacaagggtgcaaaaaacgctgtaatg
gaggtaacctcttctgctttaatgaagcatagagttgattattgcagttttaaagtaggc
gtatttacaaatctttctcaagatcatcttgatgaacatggcactatagaaaattataaa
aatgagaaaattaaattattcaaaatgtgtcctgtaggtgtaataaatctagatgacaat
attgcaggtgaaattattgaaaaaggaacttgtgaatttttcacctacggagttttaact
aatgcagatcttacagctagcgatatggtttataagcctaattccgtaagctttaatgtt
cattacaaaggtatatcctctaaagtcaaggtaaatgtacctggtgaatttactgtgtac
aatgttttagctgcaataggaagcctactttgcctcggcattgattttgaaagtatttta
aagcttgtttcaagcataaaacctgttttaggaagattagaaacaataaataatccatta
aataaaaatataataatagattatgctcatactcccgattctcttgaaaagcttcttata
atggctcgtgaaatgacaaatggcagaataataacagtatttggctgtggtggtgataga
gataaaagtaaaagaggtcttatgggcatggcagttggaatactttctgattactgcata
ataacctctgataaccctagacatgaaaagccagaggatataattagagatatagaacgc
ggcatgcaaactataaattcatcttatgaaaaaattacggatagacgctgtgcaattaaa
cgtgggattgaaatcctaaaagaagaggatatactaataatagctggaaaaggacatgaa
gactatcaaattattggagataacaaagtacactttgatgatagagaagttgttaatgaa
ttactaggataa

DBGET integrated database retrieval system