KEGG   Clostridium acetobutylicum EA 2018: CEA_G2861Help
Entry
CEA_G2861         CDS       T01864                                 

Definition
ATP-dependent exoDNAse (exonuclease V), alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cay00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CEA_G2861
Enzymes [BR:cay01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CEA_G2861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2986369..2988588)
Genome map
AA seq 739 aa AA seqDB search
MVELRCVIEAVVFKNEENGYVVANANAEGKDKITIVGCIPYIMEGQSLKISGEWIVHPQF
GKQFKIERCEEILPNSLLGIEKYLASGIISGIGPVTAKKIVNKFGEKTLEILDNDIYRLS
EIEGIGKKKIDKIYEAYSEQREVRNIMIFLQNYGVTPKQCVKIYNHYKSKAIEVVKQNPY
ILVEEISGIGFKTADKIARSLGIQGNSPFRIESGVCYVINEFCALGNTYMPIDKLVKNCI
NVLNVKKEEVEKAIYECTLSQKIKVEIINGENCVFTMEYYYCEIGITRKIITLAYDSYKS
LEIDVDQKIIQFENENKIKFAPSQVEAIEGAFSNGIEVITGGPGTGKTTIIRCITYIFEE
LNMKVFMAAPTGRAAKRMSESTGREAKTIHRMLELGYEDEVFFDNNNYSTLQCDVVIIDE
ASMIDVVLMNSLLKSIGMGTRVIIVGDVDQLPSVGPGNVLRDIIESKCVKVIRLNNIFRQ
AKESMITVNAHKINSGEMPLLNKKDKDFYFIREDNAEAITNTIISLVYKRLPLFNKSWKA
ARDIQVLAPMKKGIAGVANLNVSLQSIINPPHKSKDEIKFRDNIFRVGDKVMQIKNNYML
KWNRINGDGEKTGEGVFNGDIGFISNIDEDNNVIVIFDDEKEVTYERINLDELELAYAIT
IHKSQGSEFPVVVLPMTMGPPLLMNRNLLYTGITRAKQLVVIVGFPKAIKFMIDNDKSFE
RYSGLKWRIEDIIKEESEE
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atggtagaacttcgttgtgttattgaagctgttgtgttcaaaaatgaagaaaatgggtat
gttgttgcaaacgcaaatgcagaaggaaaagataaaattacaattgttggatgcataccg
tatattatggaaggccaatctttaaagatttcaggagaatggattgttcatccacagttt
ggaaagcaatttaaaattgaacgctgcgaagaaatactacctaattctttattaggtata
gaaaaatatttggcatcaggaattatatcgggaataggtcctgtaacagcaaaaaagata
gttaataaatttggagaaaaaactcttgagatattagataatgatatatatagattaagt
gaaatagagggaataggtaaaaagaaaatagataaaatatatgaggcgtattcagaacaa
agagaagtaagaaatattatgatttttcttcagaattatggcgttacgcctaaacaatgt
gtgaaaatatataatcactataaatctaaggctatagaggttgtgaaacaaaacccatat
attcttgtagaagagatatcaggaataggttttaagacggcagataaaatagctcgtagt
cttggaatacaaggaaactctccatttagaattgaaagtggagtatgttatgtaataaat
gaattttgtgctttaggtaatacatatatgcctatagataaacttgtaaagaactgtatt
aatgtattaaatgtaaaaaaagaagaggttgaaaaagcaatatatgaatgtactctttct
caaaagataaaggttgaaataataaatggggaaaattgtgtttttacaatggaatattac
tattgtgagataggaataacaagaaagataataactcttgcctatgatagttataaaagc
ttagagatagatgtagaccaaaagataatacagtttgaaaatgaaaataaaataaaattt
gcaccatcacaagtagaagctattgaaggagcgttttcaaatggtatagaagtaataaca
ggagggcctggtacaggtaagacaacaataataagatgcataacatatatatttgaagaa
ttaaatatgaaggtatttatggcagcacctacaggaagagctgcaaaaagaatgtccgaa
tcaacaggtagggaggccaagaccatacatagaatgctggagcttggatatgaagatgag
gtgttttttgataataataactatagtacacttcaatgtgatgttgtaataatagacgag
gcatcaatgatagatgttgttttaatgaacagtctattgaagtcaataggtatgggtact
agggttattatagttggtgatgtagaccagcttccttctgtgggacctggaaatgtgctg
agagatataattgaaagtaaatgtgtaaaggtcattagattgaataatatttttaggcaa
gcaaaggaaagtatgattacagtgaatgcgcataaaatcaatagtggtgaaatgcccctt
ctaaataaaaaggataaggatttttattttatacgagaagataatgcagaagctataacc
aatactataattagtttggtttacaagagactgccactttttaataagtcttggaaggct
gctagggatatacaagtgttagcacctatgaaaaaggggatagcaggtgttgcaaactta
aatgtaagtcttcaaagcattattaatcctcctcataaaagtaaagatgaaataaaattt
agagataatatatttagagttggcgacaaggttatgcaaataaaaaacaattatatgtta
aaatggaatagaataaatggagatggcgaaaagacaggagaaggagtttttaatggagat
atagggtttataagtaatatagatgaggataataatgtgatagttatttttgatgatgaa
aaagaggttacatatgaaagaattaacttagatgaacttgaacttgcatatgcaataact
atccataaaagccagggaagtgaattcccagtagtggttcttcctatgactatggggcca
cctcttctgatgaataggaaccttctttatacaggaattacaagagcaaagcagctagtt
gtaatagttgggtttccaaaagcaataaaatttatgatagataacgataaaagttttgaa
agatattcaggtctcaaatggagaatcgaagatataataaaagaagagagtgaggagtga

DBGET integrated database retrieval system