KEGG   Clostridium acetobutylicum EA 2018: CEA_G2909Help
Entry
CEA_G2909         CDS       T01864                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cay00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CEA_G2909 (ipk)
Enzymes [BR:cay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CEA_G2909 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3034819..3035661)
Genome map
AA seq 280 aa AA seqDB search
MNVKAYAKVNISLDVIGKREDGYHLLKMIMQSINLYDVLDIRIIDEGIKITSNRRNIPTN
DKNIAYRAAKLFMDTYKIDKGISIHINKRIPVAAGLAGGSADGAAVLKAMRDIFKKDVSD
EELINLGVKIGADIPFCIVGGTAFCEGIGEKITKLRSMNGKIIVLVKPDFGVSTKMVYTE
YDKCLDVKHPDSEGLVKAVNNGHFKFVVNNMVNVLENVTAVKYKEINEIKEKALEYNSIG
TMMSGSGPTVFSFFDNTKEAEKYFYEMKKEYNKVFITRTV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttaaagcctacgctaaggttaatatttcacttgatgttataggaaaaagagaa
gatggatatcatttattaaagatgataatgcagagcattaatttgtatgatgttttagat
ataagaatcatagatgagggaataaaaatcacatcaaataggcgtaatatacccactaat
gataaaaatatagcttatagggcagctaagcttttcatggatacatataaaattgataag
ggaataagtatacatataaataaaagaatacctgtagcagctgggcttgcagggggaagt
gctgatggtgcagccgtacttaaagctatgagagatatttttaaaaaggacgtttcagat
gaagaacttataaatttaggagttaaaataggcgctgatatccctttttgcatagttgga
ggtacagctttttgtgaaggaataggagagaagataacaaagctcagaagcatgaatggt
aagataattgtacttgttaagcctgactttggagtttcaacaaagatggtatatacagag
tatgacaaatgtttagatgttaagcatcctgatagtgaagggctagtaaaggctgtaaat
aatggccattttaaatttgttgtaaataatatggtaaatgttttggagaatgttacagca
gtaaaatataaggagataaatgaaataaaggagaaagctctagaatataactctataggt
acaatgatgagtggaagtggaccaacggttttttctttttttgataacactaaagaagct
gaaaaatatttttatgaaatgaaaaaggaatataataaagtatttataacaaggacggta
tag

DBGET integrated database retrieval system