KEGG   Clostridium acetobutylicum EA 2018: CEA_G2933Help
Entry
CEA_G2933         CDS       T01864                                 

Gene name
sul
Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
cay00790  Folate biosynthesis
cay01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cay00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CEA_G2933 (sul)
Enzymes [BR:cay01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CEA_G2933 (sul)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind CdhD Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ADZ21970
Position
3058117..3058923
Genome map
AA seq 268 aa AA seqDB search
MKIANKDFILGERTYIMGILNVTPDSFSDGGKFNNLDNALKHAAKLIEDGADIIDIGGES
TRPNHSSVDKNEELERVIPIIEAVSHEFDIPISIDTYKGEVAEAALESGAHLINDVWGFK
KDTYMAKVAAKYDVPCCLMHNRENNDYSNFLQDVIDDLKESIDIAINAGVKPENIMIDPG
IGFAKDFNQNLLLMNNLEKLNVLNFPILLGTSRKSMIGNILNLPPNKRVEGTVATSVIGV
VKGCDFIRVHDVLENKRACMVADAIIRR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagcgaataaagattttatacttggagaaagaacttacataatgggaatttta
aatgttacacctgattctttttctgatggaggaaaatttaataatttagacaatgcttta
aaacatgcagctaagctcatagaagatggcgctgatataattgatatcggtggtgaatcc
acaagaccaaaccactcttctgttgacaaaaatgaggaactagaacgggttattccaata
atagaagccgtatcgcacgaatttgatattccaatttctatagatacctataagggcgaa
gttgcagaggccgcattagaatctggtgcgcaccttataaatgatgtatggggtttcaaa
aaagatacatatatggctaaggtagctgcgaaatatgatgttccttgttgtctaatgcat
aatagagaaaataacgattatagtaactttcttcaagatgttatagatgatttaaaagaa
agtatagatatagcaataaatgctggtgttaaaccagaaaatataatgatagatcctgga
ataggttttgcaaaagacttcaatcaaaatttgcttttaatgaataatttagaaaaatta
aatgttttaaatttccctattcttttgggcacttctagaaaatcaatgataggcaatatt
ttaaatttgcctcccaacaaaagagttgagggtacagttgctacttcagtcataggtgta
gtcaaaggctgtgattttattagagttcatgacgttcttgaaaataaacgagcttgtatg
gtagctgatgcaataataaggagatga

DBGET integrated database retrieval system