KEGG   Clostridium acetobutylicum EA 2018: CEA_G2934Help
Entry
CEA_G2934         CDS       T01864                                 

Gene name
folA
Definition
Dihydroneopterin aldolase fused to 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cay00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3058929..3059756
Genome map
AA seq 275 aa AA seqDB search
MDKITIEDLEIFANHGVLGEEKVLGQKFLLSLYLTLDLRKPGLSKTLSDTVNYAELSDRV
EEEFQRENFDLIETAAEKVAEFILLNYDLIQSVKVILKKPWAPVKKHLKYVSVEIERSWH
TVYIGLGSNIADKSQNLKDALKIIDDNYLCKITKTSNFYTTRPVGYLNQDNFLNCAAEVK
TLMTPNELMDFFLETEKSLKRERKIHWGPRTIDIDILLYDDLVTYDPHCTIPHPRMAERL
FVITPLCDINPYLVHPISNKRLINIKNVLSKTQSL
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttggacaaaataactatagaagatcttgaaatatttgcgaaccacggtgttctaggagaa
gaaaaagtattaggacaaaaattcttattatctctataccttactttagatttaagaaaa
cctggattgtcaaaaactttgagcgatacagtaaattacgctgaactctctgatagagta
gaagaagaatttcagagggaaaatttcgatttaattgaaactgctgctgaaaaagtagcc
gagtttattttactaaattacgatttaattcaatctgtaaaagtaattttaaaaaaacct
tgggctcctgtaaaaaaacatttaaagtatgtttctgtagaaatagaacgaagttggcat
acagtttatataggccttggatcaaatattgcagataaatcacaaaatttaaaagatgct
cttaaaattatcgatgacaactatttatgcaaaatcacaaaaacttctaacttctatact
acaagacctgttggatatctaaaccaagataattttttaaactgcgctgctgaagtaaaa
actttaatgacaccaaatgagcttatggactttttccttgaaacagagaagtcgcttaaa
cgcgaacgaaaaatacattggggtcctcgaaccatagatattgatattttactttacgat
gatttagttacctatgatcctcactgcacaatcccccatcctagaatggcagaaagactt
tttgtcataactccattatgtgatataaacccatacttggttcatcctatatccaataag
agattaattaatataaagaatgtcttatcaaaaacacaatctctataa

DBGET integrated database retrieval system