KEGG   Clostridium acetobutylicum EA 2018: CEA_G3010Help
Entry
CEA_G3010         CDS       T01864                                 

Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cay00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CEA_G3010
   00670 One carbon pool by folate
    CEA_G3010
Enzymes [BR:cay01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CEA_G3010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3141018..3141479
Genome map
AA seq 153 aa AA seqDB search
MLSIIAALNENYVIGNENKLIWHISDDLKRFKKLTTGKTIIMGRKTFESLPGVLPNRKHI
VITKNLNYSRENVSIVHSIDEIIELKDTTEENFIIGGGEIYRALIPYCSILYLTKVHSNQ
TGDAFFPKFDENDYSIIATEKHGDYDFVTFKRR
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgcttagtataatagctgcattaaatgaaaattatgtaataggaaatgaaaataagctt
atatggcatatatctgatgatttaaaaaggtttaaaaaattaactacaggaaaaacaatc
ataatgggaagaaagaccttcgaatctcttcctggtgttctgcctaatagaaaacatatt
gtaataaccaaaaaccttaattactctagagaaaatgtatcaatagtacacagtatagat
gaaataatagaactcaaagatactaccgaggaaaattttataataggtggaggggaaata
tacagagcacttatcccgtattgcagtattctctatttaactaaagttcattctaatcaa
actggagatgcttttttcccaaaatttgatgaaaatgactattcaataattgcaactgaa
aaacatggagactatgactttgtaacatttaaaaggaggtaa

DBGET integrated database retrieval system