KEGG   Clostridium acetobutylicum EA 2018: CEA_G3010Help
Entry
CEA_G3010         CDS       T01864                                 

Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cay00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cay00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3141018..3141479
Genome map
AA seq 153 aa AA seqDB search
MLSIIAALNENYVIGNENKLIWHISDDLKRFKKLTTGKTIIMGRKTFESLPGVLPNRKHI
VITKNLNYSRENVSIVHSIDEIIELKDTTEENFIIGGGEIYRALIPYCSILYLTKVHSNQ
TGDAFFPKFDENDYSIIATEKHGDYDFVTFKRR
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgcttagtataatagctgcattaaatgaaaattatgtaataggaaatgaaaataagctt
atatggcatatatctgatgatttaaaaaggtttaaaaaattaactacaggaaaaacaatc
ataatgggaagaaagaccttcgaatctcttcctggtgttctgcctaatagaaaacatatt
gtaataaccaaaaaccttaattactctagagaaaatgtatcaatagtacacagtatagat
gaaataatagaactcaaagatactaccgaggaaaattttataataggtggaggggaaata
tacagagcacttatcccgtattgcagtattctctatttaactaaagttcattctaatcaa
actggagatgcttttttcccaaaatttgatgaaaatgactattcaataattgcaactgaa
aaacatggagactatgactttgtaacatttaaaaggaggtaa

DBGET integrated database retrieval system