KEGG   Clostridium acetobutylicum EA 2018: CEA_G3161Help
Entry
CEA_G3161         CDS       T01864                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cay00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CEA_G3161 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CEA_G3161 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CEA_G3161 (trpA)
Enzymes [BR:cay01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CEA_G3161 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3291346..3292137)
Genome map
AA seq 263 aa AA seqDB search
MANKIDLKFKELKYKNKKAMIPFVTSGYPDVETTKKIVIEMEKSGADLIELGIPYSDPVA
DGPIIQISSSGALNNGLKIKDIMNMVKEVRKNVKIPIVYMGYFGCVFKYGLEKFIKDSKE
SGVDGIVIPDLPLEERERVKEIADRYEFYIIPLVAPTSEDRIGKIVNGAKGFIYCVSTNG
VTGVRNIIANDVKAYIDVVSKASNVPKCIGFGISSPEMAQKMKEYCDGVIIGSAVMKIVE
EDIPKEEMIRKVGEFISQVNEVL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcaaataaaattgatttgaaatttaaggagttaaaatataaaaacaaaaaagctatg
attccatttgttacaagtggatatcctgatgttgaaacgacaaagaaaatagttattgaa
atggagaaatccggagctgatttaatagagcttggaataccttactcagatcccgttgca
gatggtcctattatacaaatatcttcatctggagctcttaataatggacttaagataaag
gatataatgaatatggtaaaagaggtacgtaaaaatgttaaaataccaatagtctatatg
ggatactttggatgtgtttttaaatatggattagagaagtttattaaagattccaaagaa
tctggcgtagatggaatagtaataccagatttacctcttgaagaaagagaaagggtgaaa
gaaatagcagacagatatgaattttatataataccacttgtagcacctacttcagaggat
agaataggtaaaatagttaatggggccaagggctttatatattgtgtttctactaatgga
gttactggagttagaaatattatagctaatgatgttaaagcttatatagatgtagtttca
aaagcttcgaatgtacctaaatgcataggcttcggcatatctagtccagaaatggcacaa
aagatgaaagaatattgtgatggagttattataggaagtgctgttatgaaaattgttgag
gaggatataccaaaggaagagatgattcgtaaagtaggagaatttatttcacaggttaat
gaagtattataa

DBGET integrated database retrieval system