KEGG   Clostridium acetobutylicum EA 2018: CEA_G3164Help
Entry
CEA_G3164         CDS       T01864                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
cay00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cay01100  Metabolic pathways
cay01110  Biosynthesis of secondary metabolites
cay01130  Biosynthesis of antibiotics
cay01230  Biosynthesis of amino acids
Module
cay_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cay00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CEA_G3164 (trpC)
Enzymes [BR:cay01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CEA_G3164 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh Type2_restr_D3
Motif
Other DBs
NCBI-ProteinID: ADZ22201
Position
complement(3293918..3294706)
Genome map
AA seq 262 aa AA seqDB search
MILDDIVRDKKLQLIEDKKALSLDDIKSKLNSLNLDKRNFKEALEKENISIIAEIKKASP
SKGVIREDFNPVKIGQIYENINIDAVSILTEKKYFLGKNEYIKIVKEVNSKPILRKDFIV
DEYQLYEAKLIGADAVLLIAAVLKDKLECFYNRTLELGLDSITEVHNEEEAKLASEIGCS
IIGINNRDLRDFSTDITTTKRLMKYVPRDRIIVSESSIKTPEDILYLRSIGVNAVLIGET
FMRNIDDLKGINEFLKKAKDNG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
ttgatacttgatgatattgttcgtgataaaaagctccagcttatagaggataaaaaggcg
cttagcttagatgatataaaatcaaaattgaattctttaaatttagataagagaaatttt
aaagaagctctcgaaaaagaaaatatatctataatagcagaaattaaaaaggcatcacca
tctaagggagttataagggaagattttaatcccgtaaaaataggacaaatttatgaaaat
ataaacatagatgcagtgtcgattcttacggaaaagaaatatttcctgggaaaaaatgaa
tacattaagattgtaaaagaagtgaactctaaacccatacttagaaaggattttatagta
gatgaatatcaactttatgaagccaagcttataggagcagacgctgttttgttaatagca
gcagtacttaaagataagctggaatgcttttacaatagaacactggaacttggacttgat
tctataactgaggttcataatgaggaagaagcaaaattagcgtctgaaattggttgcagc
ataataggaataaacaacagagatttaagggatttttctacagatattacaactacaaag
aggcttatgaaatacgtaccaagggatagaataattgtttcagaaagctcaataaaaaca
ccagaagatatattgtatttgagatcaataggagtgaatgctgttttaataggtgaaacc
tttatgagaaatatagatgatttaaagggtataaatgaatttttaaagaaggctaaggat
aatggttaa

DBGET integrated database retrieval system