KEGG   Clostridium acetobutylicum EA 2018: CEA_G3376Help
Entry
CEA_G3376         CDS       T01864                                 

Definition
Pectin methylesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cay00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CEA_G3376
   00500 Starch and sucrose metabolism
    CEA_G3376
Enzymes [BR:cay01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     CEA_G3376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3550177..3551142)
Genome map
AA seq 321 aa AA seqDB search
MIVSKNDDGDFDTIQKAVDSVSKNNKKRVIIKVKAGVYKEKLSIRKPFISLIGEDVSSTV
ITFNDSANTLMANKERMRTFNSYTMFVDGDDFICENITVENNAGDGDLVGQAVAVYADGD
RMIFRNCRLLANQDTLFTGPLPPKPIEGNNFGGPKDGMKRRDVRQYYENCYIRGDIDFIF
GSATAVFNKCEIFSNDKNKEVNGFIAAASTPEGKEFGYVFLDCKFISDARKHTVYLGRPW
RDYAKTVFIRCFMGEHIIPEGFHNWNKANAEKESYYAEYKSYGPGAANDKRVKWAKLLND
KEVEKYSITNILKGNDDWKVI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
ttgatagtatcgaaaaatgatgatggggattttgatacaatacaaaaagcagtggacagt
gtgtctaagaacaataagaaaagggttattataaaggttaaagctggagtttacaaggaa
aaactaagtataagaaaaccttttataagtctaattggtgaagatgtaagtagcacggtc
ataacctttaatgattcagctaataccttgatggctaataaagagagaatgagaactttt
aactcctatacaatgtttgtggatggcgatgattttatttgtgaaaatataactgtagaa
aataatgcaggagacggagatctagtaggacaagcagttgcggtttatgctgatggcgat
agaatgatttttagaaactgtagattattagcaaaccaagataccctatttacaggacca
cttcctccaaagcctatagagggaaacaattttggtgggccaaaggacggtatgaaaaga
agagatgtaaggcagtattatgaaaattgttatataagaggagatatagactttatattt
ggttccgccactgctgtattcaataaatgtgagattttttctaatgataaaaataaagag
gttaatgggtttatagcagcagcctcaacgccagaaggaaaagaatttggatatgtattc
ttggattgcaaattcataagtgatgcaaggaagcatactgtttatttaggaagaccttgg
agagactatgcaaaaacagttttcataaggtgttttatgggagaacacatcattccagaa
ggttttcataattggaataaggcaaatgctgaaaaagaaagctactatgcagagtataaa
agctatggtccaggtgcagcaaatgataaaagagttaaatgggcgaaacttttaaatgac
aaggaagtagaaaagtattccataaccaatattcttaagggaaatgatgattggaaggtt
atttaa

DBGET integrated database retrieval system