KEGG   Clostridium acetobutylicum EA 2018: CEA_P0010Help
Entry
CEA_P0010         CDS       T01864                                 

Gene name
bgla
Definition
Beta_glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cay00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
EA2018plasmid:11140..12549
Genome map
AA seq 469 aa AA seqDB search
MRHSKLKDFPKDFLWSASTSAYQVEGAWNEDGKGMSVQDAKTSLPEGTSDFKVASDHYHH
FEEDIAFLGEMGLKAYRFSISWTRIIPDGDGKINTKGVQFYHKLIDACLSYNIEPIVTMY
HFDLPFELEKKGGWNNRTTIDAFLKFSKILFEQYGSKVKYFLTINEQNMMILHGAAIGTS
KGSGINIWKELYQQNHNMLVAQAKAMELCHKLCPNSKIGPAPNIASIYPASSKPEDYLAA
QNFTAIRNWLYLDMAVFGRYNSTAWSYLEEIDAVPKIEEGDMEILRNAKPDFIAFNYYNT
ATVKANNDAKKVQDSSGDQQLAVFEAGVFEGVQNPNLEKTEFGWEIDPVGFRITLREVYD
RYNLPIIVTENGLGAFDKLEDGTVHDDYRIEYYKKHLHEIKEAITDGVKVFGYSPWSAID
LVSTHQGVTKRYGFIYVNRDEFDLKDLKRYKKDSFYWYKKVIEENGNNL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgagacatagcaaactaaaggattttccaaaagattttctttggagtgcatcaactagt
gcgtatcaggttgaaggtgcatggaatgaggacggaaaagggatgtcggtgcaggatgca
aaaacttcacttccagaaggaacaagtgattttaaggttgccagcgatcattatcaccat
tttgaggaggatattgcttttttaggagaaatgggacttaaagcctataggttttcaatt
tcttggacccgaataattccagatggtgatggaaagataaatacaaagggtgtacaattc
tatcataaattaattgatgcttgtttgagttataacatagagccaattgtaactatgtat
cattttgatcttccttttgaattggagaaaaaaggtggttggaataatagaactactatt
gatgcatttttaaaatttagtaagattttgtttgaacaatacggctcgaaggtaaagtat
ttcttaactattaatgagcagaacatgatgattcttcatggagctgctattggtacgtct
aaaggttctggtataaatatatggaaggaattatatcagcaaaaccacaacatgttagtt
gcacaggcaaaagctatggaattatgccataaactttgtcctaattctaaaataggtcct
gcgcctaatatagcttcaatatatccagcatcctcaaagccagaagattaccttgctgca
cagaattttacagctataagaaattggctttatcttgatatggccgtttttggaaggtat
aattcaacagcgtggtcataccttgaggaaatagatgctgtgccaaaaatagaagaagga
gacatggagatattaagaaatgcaaaaccagattttatagcttttaattactataataca
gctacagttaaagcaaataatgatgctaaaaaggtacaagattcaagtggagatcaacaa
ttagcagtttttgaagcaggagtatttgaaggagtccaaaatcctaatcttgaaaagacg
gaatttgggtgggaaatagatcctgttggttttagaataactttaagagaagtatatgat
aggtataatcttccaattatagtaactgaaaatggtcttggagcttttgataagttggag
gatggaacagttcatgatgattatagaattgaatactataagaaacatttgcatgaaata
aaagaagctattacagatggtgtgaaggtatttgggtattctccatggagtgcaattgat
cttgtttcaacacatcaaggagtcactaaaaggtatggctttatatatgtaaatcgtgat
gaattcgatttgaaggatttaaagagatataaaaaagatagtttttattggtacaagaag
gttatagaagagaatgggaataacttataa

DBGET integrated database retrieval system