KEGG   Corynebacterium argentoratense: CARG_00955Help
Entry
CARG_00955        CDS       T02821                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
caz  Corynebacterium argentoratense
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:caz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CARG_00955
Enzymes [BR:caz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CARG_00955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
190082..191596
Genome map
AA seq 504 aa AA seqDB search
MEQHTQAPVVGIIGAGLAGLVAAYETHKLLPQATIKIYEAEDRIGGKLRTVAFEHGPVDM
GAEAYLAKAQHATDFFTELGLADRLREPSGMPSMLYLPDGNGELKPLPRGTLMGIPAAAE
SVAHLVDEATARRIDGDHPVTWQAPTGLTQADASVADLVREVHGDQVLQRIVEPLLGGVY
ASSPELIGVRAALPRLAEQFDAMVAAGQTPRLTSAVKTVLTNNQSTYVADTDQPGAPKKP
VFSTFVGGYADLYETLAEQSGAEIYSDAFISDINPAQNAQQGSGQWTIRGQGINDTVDAL
ILAVPAPTAAALCSRSGVEALHQAATHLRTIPVASSTVVGLRLPEGGLPDYSGILVSRAD
NPTVQAKAFTFSSKKWPHIGSRPGDLVRVSYGRLDNTNPLAALTDIARADEDTLVDAALD
DLHAVCGLDARTAGVEEIFVQRWYGGLPCYQVGHAERIATIDTSLQPLGTIALTGAWKHG
VGVPAIIEDAQHAAHHTTRALTKS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggagcaacacacccaagcacccgtcgtaggcatcatcggcgcaggcctcgcagggctt
gtcgcagcctacgaaacccacaagctactcccacaggccaccattaaaatctatgaggcc
gaagaccgcatcggcggcaaactccgcaccgtcgccttcgaacacggccccgtcgacatg
ggcgccgaagcctacctcgcaaaagcgcaacacgccacagacttcttcaccgaactaggg
ctagccgaccgcctacgcgaacccagcggcatgccctccatgctctacctgcccgacggc
aacggcgaacttaaacccctgccccgcggcaccctcatgggtattcccgcagcagccgag
agcgtcgcccacctcgtcgacgaagccaccgcccgccgcatcgacggagaccaccccgtc
acctggcaagcacccacaggcctcacccaagcagacgcatccgtggccgacctcgtccgc
gaagtccacggagaccaagtcctccaacgcatcgtcgaaccactgctcggcggagtctac
gcatcaagcccagaactcatcggcgtccgcgcagcactcccacgcctcgcagaacaattc
gacgccatggttgccgcaggccaaacaccccgcctgaccagcgcagtaaaaacagtcctc
acaaataaccaatccacctacgtcgccgacaccgatcaacccggtgcacccaaaaagcca
gtcttctccacctttgtcggcggctacgccgacctctacgaaaccctcgccgaacagtcc
ggcgccgaaatctacagcgacgccttcatcagcgacatcaaccccgcacaaaacgcacag
cagggtagtggtcaatggaccatccgcggccaaggcatcaacgacaccgtcgacgccctc
atcctcgccgtacccgcacccaccgcagcagccctctgctcccgcagcggggtagaggcc
ctccaccaagccgccacccacctgcgcaccatccccgtggcatcctccaccgtcgtcggc
ctgcgcctgcccgaaggcggacttcccgactactccggaatcctcgtctcccgcgccgac
aaccccacagtgcaagccaaagccttcaccttctcctccaaaaaatggccccacatcggg
tctcgccccggagacctcgtccgcgtgtcctacggacgcctcgacaacaccaacccgctc
gccgcgctcaccgacatcgcccgcgccgacgaagacaccctcgtcgacgccgccctcgac
gacctccacgcagtgtgcggcctcgacgcacgcaccgccggagtcgaggaaattttcgtc
caacgctggtacggcggcctaccttgctaccaagtaggacacgccgaacgcatcgccacc
atcgacacatctctacagcccctgggcaccatcgccctcacaggagcctggaaacacggc
gtcggcgtgcccgccatcatcgaagacgcacaacacgccgcccaccacaccacccgcgca
ctcacaaaatcctga

DBGET integrated database retrieval system