KEGG   Corynebacterium argentoratense: CARG_03200Help
Entry
CARG_03200        CDS       T02821                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
caz  Corynebacterium argentoratense
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:caz00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CARG_03200
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CARG_03200
   00650 Butanoate metabolism
    CARG_03200
  Amino acid metabolism
   00360 Phenylalanine metabolism
    CARG_03200
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CARG_03200
   00622 Xylene degradation
    CARG_03200
   00621 Dioxin degradation
    CARG_03200
Enzymes [BR:caz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CARG_03200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
630572..631492
Genome map
AA seq 306 aa AA seqDB search
MTKKYTAAVVGPGNIGTDLLMKLLKNSKYVEPVYMIGVDPESDGLARAEKMGIQASAGGV
DWLLEQRERPDLVFEATSAYAHLANAPRYREAGIRAIDLTPAAVGPYFCPSVNLDALKTV
DNVNMITCGGQATTPIVAAISRVVDVQYAEIVASISSRSAGPGTRANIDEFMETTSRALE
KVGGAKKGKAILILNPVEPPMLMRNTVYCALPPEAAEPGELQDRIRQSISEMVERVQSYV
PGYRLTAEPQFDRGREDWNGWGRVMVLIEVRGAADYLPDFAGNLDIITAAAVATADTYVE
LLEGQE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaaaatacactgctgccgtggtcgggccggggaacatcggcactgacttgttg
atgaaactgctgaaaaactccaagtacgtggagccggtatacatgatcggcgttgatcct
gaatccgacgggctagccagggctgaaaagatggggatccaagcttccgctggtggcgtg
gactggttgctggagcaaagggaacgaccagacttagtgttcgaggcaactagtgcctat
gcgcacctggccaatgctccgcgatatcgtgaggcaggcatccgtgcgatcgatctcact
ccggctgcagtaggtccgtacttttgcccttccgtgaacttggatgcgctgaagacggtg
gacaacgtcaacatgattacttgtggcgggcaggccactaccccgatcgttgcggcgatc
agccgggtggttgatgttcagtatgccgagatcgttgcatccatcagttctagatctgcg
gggcctggtacacgagccaacattgatgagtttatggagactacttctcgggccctcgag
aaggttggtggtgcgaaaaagggcaaggcgattttgattctgaaccctgttgagccgccg
atgctgatgcgtaacacagtttattgtgctctgccgccggaagcagcagagcctggtgaa
ttacaagaccggattaggcagtccattagcgagatggttgaacgcgtgcagtcctatgtt
ccggggtatcgcctgactgccgagccacagtttgatagggggcgcgaagactggaatgga
tggggccgcgtgatggtcctgattgaggttaggggtgcggctgattacctgccggacttt
gctggcaacctcgacattattactgcggcagcggtagcaaccgccgatacgtatgtggaa
ttgctggaagggcaggagtaa

DBGET integrated database retrieval system