KEGG   Corynebacterium argentoratense: CARG_06365Help
Entry
CARG_06365        CDS       T02821                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
caz  Corynebacterium argentoratense
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:caz00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1311142..1313310
Genome map
AA seq 722 aa AA seqDB search
MNTIPERERLNHCHYHDPHGVYGWHDNTIRTRQIGATSISVELLDGTVIAMEHAGEGYFT
ADVSGHERCDYRFQINWGEHSTTLADPYAFLPTLGPMDLHLIGEGRHERLWDVLGANTTS
YTTAMGEVRGTAFAVWAPNAIGVAVVGDFNGWNAAQHPMRSLGSSGVWELFIPEVHAGAI
YKFAVQTPEGHRIDKADPLAKRAEVPPQTGSIVVESSYTWGDKKWMSSRERVDHDSSPMS
IYEVHLGSWNMGKNYEDLATELVTYVSDMGYTHVEFMPVAEHPFGGSWGYQVSGYYAPTS
RWGTPDQLRHLIDAMHQAGIGVIIDWVPAHFPKDDFALARFDGRPVYEHPDWRRGEQRDW
GTYVFDFGRPEVRNFLVANALYWAQEFHIDGLRVDAVASMLYLDYSREEGEWAPNQYGGR
EHLEAVQFLQEMNATVHREHPGVLTIAEESTSWPGVTTPTEAGGLGFSMKWNMGWMNDTL
EYFSEDPINRRYHHNEITFSMVYAYSEKFVLPISHDEVVHGKGTLWTRMPGDSWNKAAGV
RTLLAYMWAHPGKQLLFQGQDFAQVGEWSEARSLDWGDQDGWEGEYHAGALELVRALNTI
YKRTPALFTQDFVPEGFSWNKSDDADRNVLSFLRHSAPDADGNVETLMCVLNLGGQSHTD
YTLGVPEAGTWKLLLNTDAAVFGGADNPLGDAQAVTYPWDGFDASVTLHLPAMSAQWYKL
QR
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgatccccgaacgcgaacgcctcaaccactgccactaccacgaccctcacggc
gtctacggctggcatgacaacaccatccgcacccgccagatcggcgccaccagtatctct
gtagagctactcgacggcaccgtcatcgccatggagcacgccggcgaaggctatttcacc
gctgacgtcagcgggcacgagcgctgcgactaccgctttcaaatcaactggggcgagcac
agcacgacgcttgcagacccctacgccttcctgcccacccttggccccatggatctgcat
ctgatcggtgaaggccgccatgaacgcctgtgggatgtccttggagccaacaccacctcc
tacaccaccgcgatgggcgaagtccgcggcacagccttcgcagtgtgggcacccaatgcc
attggcgtcgctgtcgttggtgatttcaacgggtggaatgccgcccagcaccccatgcgc
agtctcggctcctctggcgtgtgggagctgtttatccccgaggtccatgccggggcgatc
tataagtttgcggtccaaacccccgagggccaccgcatcgacaaagccgaccccttggct
aagcgcgccgaggtcccgccgcagaccggatcgattgttgtcgaatcctcctacacctgg
ggcgacaagaagtggatgagctcccgcgaacgcgtcgaccatgactcctcccccatgagc
atctacgaggtccacctgggctcgtggaacatgggcaaaaactacgaggacctcgccacc
gagctcgtcacatatgtttccgacatgggctacactcacgtcgaattcatgccagtcgct
gagcaccccttcggtggctcctggggctaccaggtgtctggttactatgcgccaacttct
cgttggggaaccccggatcagttgcgtcacctcatcgacgccatgcaccaagccggcatc
ggggtcattatcgactgggttcccgcccacttccccaaagacgactttgcactggctcgg
ttcgacggccgccctgtctacgagcacccggactggcgccgaggcgagcagcgagactgg
ggcacctatgttttcgatttcggacgtcccgaggtgcgcaacttcctcgtggctaacgcc
ctgtactgggcgcaggaattccacatcgacggactgcgagtcgacgccgtcgcgtccatg
ctctacctcgactactcacgcgaagagggcgaatgggcacccaaccaatacggtgggcgc
gaacacctcgaagcggtccagttcctgcaagagatgaacgctactgtccaccgcgagcac
cctggcgtcctgaccatcgctgaagaatccacctcgtggccgggggtcaccacccccaca
gaagcaggcggcctcgggttctccatgaagtggaatatgggctggatgaacgacaccctc
gagtacttctccgaggaccccatcaacaggcgctaccaccacaacgagatcactttctcc
atggtgtacgcctacagcgaaaagttcgtcctccccatcagccacgatgaggtcgtccac
ggcaagggcaccttatggacccgcatgccgggagactcttggaacaaagcagctggcgtg
cgcacactactggcctacatgtgggcgcatcccggtaagcaacttctattccagggccag
gacttcgcgcaggttggcgaatggtccgaggcacgttccctggactggggcgatcaagat
ggttgggagggcgaataccacgccggggcgttggaactggtccgagccctcaacaccatc
tacaagcgcacaccagcactattcacgcaggatttcgtgcctgagggcttcagttggaac
aaatccgatgacgctgaccgcaacgtactgtccttcctacgccacagcgccccagatgcc
gatggcaacgtcgaaacactgatgtgtgtgctcaacctcggcggacaaagccacaccgac
tacactctcggtgtcccggaggcaggcacctggaagctcctgcttaacacagacgccgcc
gtgttcggcggtgcagacaaccccttgggcgacgcccaagccgtaacctatccatgggac
ggattcgacgcgtcagtcaccctacatctgcccgctatgagtgcgcagtggtacaaactg
caacgttaa

DBGET integrated database retrieval system