KEGG   Corynebacterium argentoratense: CARG_07205Help
Entry
CARG_07205        CDS       T02821                                 

Definition
hypothetical protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
caz  Corynebacterium argentoratense
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:caz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CARG_07205
Enzymes [BR:caz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CARG_07205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1491767..1493827
Genome map
AA seq 686 aa AA seqDB search
MSTFDEQLRGLADSYGIATQFYSYTGEHVQVSTDTLLKTLHALGVDLAEHTEEAIEGAYR
RREDARWSRLLPPCVVTKQGDQPRVDVHVDDGAPVEVWITCEDGSRREAFQVDNFNPPRE
VEGILRGEATFGLPEDLPLGWHRLHARSTGSEEVVDLIVTPRRLSTADAFVAQPASGVMV
QVYSVRSSDSWGMGDFHDVATLADMVAREAGADFLLINPLHAAEPAPPVEDSPYLPTTRR
FVNPLYLRIEDVPEYNHVTFTDAQREVFAQLKALSSSGGLIDRNRIYEAKLAALIQMFEA
RLPEREAAFDAFVAHEGEGLELFARWCAATTGVDPVFYMWLQFLCDEQLAAAQAAAKDAG
MRIGIMADLAVGVHPGGSDAHNLSAVLASEASVGAPPDGYNQLGQDWSQPPWHPVALAEA
GYRPWRDMLRTVLKHAGGIRVDHVLGLFRLWWIPRMQPATTGTYVYYDHEALVGILALEA
ERAGAVVIGEDLGTFEPWVQDALAERGIMGTSILWFESEGDQPKHAGHYRPLALSSVTTH
DLPPTAGFLAGTHIRLRDELGLFERPIEVEEAEDVAWQNRVLSQVAEYGFCPPLESDKRG
QRGDTLELVAGLHRYVASTPSALACTSLVDMVGDVQAQNQPGTTKDLYPNWCQPLRDETG
AVVLLEELTRHPWFRVIAEAGRRPNG
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacttttgatgagcagttgcgtggtttggccgattcttatgggattgcgacgcag
ttctattcctataccggcgaacacgtccaagtttctacggatacgctgctcaagacgctg
catgcgctgggggttgatcttgctgagcacactgaagaggctatcgagggggcctatcga
cgccgcgaggatgcgcgatggtcgcgcctgttgcctccctgcgtagtgaccaagcagggc
gaccagccccgagtggatgtccatgttgatgatggcgcccccgtcgaggtgtggattacc
tgcgaggatggcagccgtcgcgaggcttttcaggtggataatttcaatcctccccgcgag
gttgaggggattttgcggggggaggccacgtttgggctgccagaggacctgcctttgggg
tggcaccgtttgcacgcgcgctcgacgggttcagaggaagttgtcgatttgattgtgacg
ccgcgtcgcttgtcgactgcggatgcttttgttgcccagcctgcctcgggtgtgatggtg
caggtttattcggtgcgctcctcagatagttggggcatgggcgattttcatgacgtcgct
actttggccgacatggtggcgcgagaagccggcgctgattttctgctgatcaatcctttg
cacgctgccgagcctgccccgcctgttgaggattcgccctacttgccaaccaccaggcgt
ttcgtcaatccgctgtatctgcgtattgaggatgtgcccgagtacaatcacgtcactttt
acggatgcacagcgcgaggtgtttgcccagcttaaggctttgagctccagcggcggtttg
attgaccgcaaccgaatttacgaggcaaagctggctgccttaatacaaatgtttgaggct
cgcctgccggagcgcgaagctgcttttgatgcgtttgtggcgcacgagggcgaaggactt
gagctctttgcccgatggtgtgctgcaaccactggcgtggatcccgtgttttatatgtgg
ctgcagttcctgtgtgatgagcaattggctgcagcacaggccgcagctaaagatgcggga
atgcggatcggcatcatggctgatcttgctgtgggcgtgcatcctggcggttccgatgct
cacaacttgtctgcggtgctcgcttccgaagcctctgttggcgccccgccggatggttac
aaccagctgggtcaggattggtcgcagcccccgtggcacccggtagctttagcagaggcc
ggttaccgtccttggcgcgacatgctacgcacggtactcaagcatgccggcggtattcgc
gttgaccacgtgctcggcttgttccgcctgtggtggatcccccggatgcagccggcgacc
acgggcacctacgtctactacgaccatgaggccctcgtggggatcttggcactagaggcc
gagcgtgcgggcgcggtcgtcattggtgaagaccttggcacctttgagccgtgggtgcag
gatgctttggccgagcgtggcatcatgggcacctcaattttgtggttcgagtccgagggc
gatcaacctaaacatgctggccattaccgccccttggcgctgtcctcggtgaccacgcat
gatcttcctccgacggctggcttcctagccggcactcacatccgcttgcgtgacgagctc
ggcctgtttgaacgccccatcgaggtcgaggaagctgaggacgtcgcgtggcaaaaccgg
gtgctgtcacaggttgcggagtatggcttctgtccgccgttggaaagcgacaagcgcggc
caacgcggcgacactctagaactcgtagccggcttgcaccgctatgtggcctctaccccc
tcggcgttggcatgtacctctttggtggacatggtcggcgatgtgcaggcccaaaaccag
ccgggcaccaccaaagacctgtaccccaactggtgccagcctttacgggatgaaaccggt
gctgtggtgcttctcgaagagctcacgcgccacccctggtttcgcgttattgcggaagct
ggcaggcgccccaacggctag

DBGET integrated database retrieval system