KEGG   Corynebacterium argentoratense: CARG_07305Help
Entry
CARG_07305        CDS       T02821                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
caz  Corynebacterium argentoratense
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:caz00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CARG_07305
Enzymes [BR:caz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CARG_07305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1513371..1514327
Genome map
AA seq 318 aa AA seqDB search
MSSSVSPKTAAPSVDVVVVGSINADQVVRVPRHPKPGETLLGSSLTHTAGGKGANQAVAA
ALQGARVAFVGAYGCDAYADVALEFLRSSGVYLAATRELDTNTGFAAIQVSDDGENSIVV
IPGANEQVDAAFVSDNGSVIDDAAMVLLQGEVPASGFAQAVDMAVAAGRRVVVNLAPVIE
VDREALLAADPLMVNEHEGGLVLEQLGLPVPAGDAARVAALLEAGFASVVMTLGARGALV
ASADAPEPVAVASPKVTAVDTTGAGDCFAGAFVAHMAAHPDQCDLVAAAEHAVRVAAFSV
QHPGAQVSYPDKEAELPC
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtctagttctgtttcgccaaagaccgctgccccgtctgttgatgttgtggtggttggt
tcgatcaacgccgatcaggttgtgcgtgtgccccgccacccgaagcccggggagaccctg
ttgggttcttctctgacgcatacggctggcggtaagggcgcgaatcaggctgttgctgcg
gcgttgcagggcgcgcgggtggcgtttgttggcgcctatggttgcgacgcatacgccgat
gtcgcgctggagtttttgcgttccagcggcgtctatttggccgccactcgcgagttggac
acgaatactggttttgctgctatccaggtgtcggatgacggggagaactcgattgtggtg
atccccggagcgaacgagcaggtggacgccgcgtttgtctccgacaatggttccgtgatt
gatgacgccgcgatggttctgttgcagggcgaggttccggcttctggttttgcccaggct
gtagacatggctgtggcggcgggccggcgcgtggtggttaatcttgctccggtgattgag
gtggatcgtgaggccttgttggctgcggatccgttgatggtcaatgagcatgagggcggt
ttggtgcttgagcagcttggcctgccggtgccggcgggcgatgctgctcgtgtggctgcc
ctgctggaggctggtttcgcgtcggttgtgatgactcttggtgcccgcggtgcgctggtt
gcgtctgcagatgcccctgagcctgttgctgttgcgagccccaaggtcaccgccgtggat
acaacaggcgccggtgattgcttcgctggtgctttcgtggcgcatatggcggcgcatccg
gatcagtgtgatctggtggctgcggcggagcatgcggtccgggtggcggctttctcggtg
cagcatcctggtgcgcaggtctcttacccagataaggaggctgaactgccgtgttaa

DBGET integrated database retrieval system