KEGG   Clostridium botulinum A ATCC 19397: CLB_0209Help
Entry
CLB_0209          CDS       T00574                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cba  Clostridium botulinum A ATCC 19397
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cba03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
194944..197178
Genome map
AA seq 744 aa AA seqDB search
MQEIQGFIEDILFKNDENGYVVAKIRKKKELITIVGCMPYITEGQNLKLKGEWVIHPQFG
NQFKVEICEEIVPDTVAGIERYLSSGIISGIGPVTAKKIVKKFGEETLNILDNNIERLTE
IEGIGKKKIEVIYDSYIKQNEVRNIMMFFQNYGVTPNQCMKVYKRFGENSISIVKENPYI
LTEEIRGIGFKTADKIARSLGIASNSPFRIQSGINYIINGFCSLGNTYMPLEKLISEAMD
ILGVKEEEIHENIYNNVAENKLKIEKVKERSCVFTLPYYYCELGVTKKILSLSLSQYDNL
NINIEDEIVRFEKNNNIKFHDSQREAIKGALENGVEIITGGPGTGKTTIINCITEIFEKA
NMKVYMAAPTGRAAKRMSETTGREAKTIHRMLEMGVSEDDTEEVFSKGEETPLECDVVII
DEASMIDIILMNTLLKAIALGTRIIIVGDVDQLPSVGPGNVLRDLIESKCVKVVRLKEIF
RQSKESMIIVNAHRINDGEMPIINKKDKDFYFIECSEPKKIVNTLLELSNRRLPKFNKSW
HKIHDIQILSPMRKGILGVSSLNKELQSVLNPKNDSKKEMEFKDYIFRVGDKVMQTKNNY
SLKWTRASGEGEAEGLGIFNGDVGYIEDIDEEKETIQVLFDNERRVVYENLYLDEIDLAY
AVTIHKSQGSEFPVVIMPAFKGPPLLMNRNLLYTGITRAKRLVVLVGSLKAINFMVQNDK
IFERYSLLKWRISNILDTEIINGE
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaatacagggatttatagaggatatactttttaaaaatgatgaaaatgggtat
gtagtggcaaaaataaggaagaagaaagagcttataaccatagtcggatgtatgccctac
ataacagaaggacaaaacttaaaattaaaaggtgaatgggtaattcatccacaatttggt
aatcaattcaaagtagaaatatgtgaagaaatagtacccgatactgtagctggcatagaa
agatatttatcctcaggaatcatatcaggtataggcccagtgactgcaaaaaaaattgta
aaaaaatttggagaagaaacattaaatatattagacaataatatagaaagattaacagag
atagagggaataggaaagaagaagatagaagtaatatatgattcctatataaaacaaaat
gaagtgcgaaatataatgatgttttttcaaaattacggagttacacctaaccaatgcatg
aaagtttataaaagatttggagaaaattctatatcaatagttaaagagaatccatatata
cttacggaagaaataagaggaataggtttcaagacagcagataaaatagctaggagctta
ggaatagcctctaattcaccttttagaattcagagtggaataaattatataataaatgga
ttctgtagtttaggaaatacttatatgcctttagagaagcttataagtgaggctatggac
atattaggagtaaaagaagaagaaatacatgaaaatatatataataatgtagcagaaaat
aaattaaagatagaaaaagtaaaagaacgaagttgtgtttttactctaccgtattattat
tgcgaattaggagttacaaaaaaaatacttagtttatctttgtcacaatatgataattta
aatataaatatagaagacgagatagtgaggtttgaaaaaaataataatataaaatttcat
gattctcaaagagaggctataaaaggtgccttagaaaatggagtagaaataataacagga
ggccctggtacaggaaaaacaactattattaattgtataacagagatatttgaaaaagct
aatatgaaagtttatatggcagcacctacaggaagagcggctaaaagaatgtctgaaact
acaggtagagaagctaaaacaatacataggatgttagaaatgggtgtatctgaggatgac
acagaagaagttttttctaaaggtgaagaaactcctttagaatgtgatgtagtaataata
gatgaagcttccatgatagatataatattaatgaatacactgttaaaggccatagcttta
ggtacaagaataataatagttggggatgtagatcaacttccctcagtaggtccagggaat
gtattaagagatttaatagaaagtaagtgtgtaaaggtagttagattaaaggagatattc
agacaatctaaagaaagtatgattatagtaaatgcccatagaataaatgatggagagatg
ccaattataaataaaaaagataaagatttttattttatagaatgtagtgaacctaaaaaa
atagttaatacattattagaactttcaaatagaagattgcctaaatttaataaaagttgg
cataaaattcatgatatacaaatactatctccaatgagaaagggaattctaggagtttct
agtttaaataaggaattacaatctgttttaaaccctaaaaatgattcaaaaaaagaaatg
gaatttaaggactatatatttagagtaggagataaagttatgcaaaccaaaaataactac
tctttaaagtggaccagagcaagtggtgagggggaagcagaggggttaggaatatttaat
ggagatgtaggatatatagaggatatagatgaggaaaaagaaacaattcaggtcttattt
gataatgaaagaagagtagtatatgaaaatttatatctagatgaaatagatttagcttat
gctgtaactattcataaaagtcaaggtagcgaatttccagtagtaattatgccagctttt
aaaggtcccccacttttaatgaatagaaatttattgtatacaggaataacaagagcaaaa
aggcttgttgtcttggtaggatctttaaaagctattaattttatggtacagaatgataaa
atttttgaaagatactctcttttgaagtggcgtataagtaatattttagatactgaaatt
ataaatggagaataa

DBGET integrated database retrieval system