KEGG   Clostridium botulinum A ATCC 19397: CLB_0269Help
Entry
CLB_0269          CDS       T00574                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cba  Clostridium botulinum A ATCC 19397
Pathway
cba00010  Glycolysis / Gluconeogenesis
cba00051  Fructose and mannose metabolism
cba00562  Inositol phosphate metabolism
cba01100  Metabolic pathways
cba01110  Biosynthesis of secondary metabolites
cba01120  Microbial metabolism in diverse environments
cba01130  Biosynthesis of antibiotics
cba01200  Carbon metabolism
cba01230  Biosynthesis of amino acids
Module
cba_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cba_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLB_0269 (tpiA)
   00051 Fructose and mannose metabolism
    CLB_0269 (tpiA)
   00562 Inositol phosphate metabolism
    CLB_0269 (tpiA)
Enzymes [BR:cba01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CLB_0269 (tpiA)
Exosome [BR:cba04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CLB_0269 (tpiA)
  Exosomal proteins of bladder cancer cells
   CLB_0269 (tpiA)
  Exosomal proteins of melanoma cells
   CLB_0269 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABS34450
UniProt: A7FQN8
Position
262740..263486
Genome map
AA seq 248 aa AA seqDB search
MRTAIIAGNWKMNKTVKEAVELVKELKPLVKDAKCDVVVCPTYVCLPAVLEEVKGSNIKV
GAQNMHFEESGAYTGEIAPKMLEELGVHYVIIGHSERRQYFNETDETVNKKVKKAFEHNL
IPIVCCGESLEEREGNITEKVLEGQIKVGLKELSKEQVEKLVIAYEPIWAIGTGKTATDE
QANETIGYIRTVVKAMYGESVADKIRIQYGGSVKPGTIKAQMAKEEIDGALVGGASLKAE
DFAAIVNY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaacagctataatagcaggaaactggaagatgaacaaaactgtaaaagaagcagta
gaattggttaaagaattaaaaccacttgttaaagatgcaaaatgtgatgtagttgtatgt
cctacttatgtatgccttccagcggtattagaagaagttaaaggaagcaatataaaagta
ggtgctcaaaatatgcactttgaagaaagtggagcttacacaggtgaaatagcacctaaa
atgttagaagaactaggagttcattatgtaattataggacatagtgaaagaagacaatac
tttaatgaaacagatgaaactgtaaataaaaaagtaaaaaaagccttcgaacataactta
attccaatagtttgttgtggagaaagcttagaagaaagagaaggaaatataacagaaaaa
gttttagaaggacaaataaaagttggattaaaggaattaagtaaagaacaagtagaaaaa
ttagttatagcatatgaaccaatttgggctataggaacaggaaaaactgccacagatgag
caagcaaatgaaactataggatatataagaactgtagtaaaagctatgtatggtgagagc
gttgcagataaaataagaattcaatacggtggatctgttaagcctggcactatcaaagct
caaatggctaaagaagagattgatggtgcattagtaggtggtgcaagcttaaaagcagaa
gattttgcggctatagtaaattattaa

DBGET integrated database retrieval system