KEGG   Clostridium botulinum A ATCC 19397: CLB_0556Help
Entry
CLB_0556          CDS       T00574                                 

Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
cba  Clostridium botulinum A ATCC 19397
Pathway
cba00010  Glycolysis / Gluconeogenesis
cba00030  Pentose phosphate pathway
cba00051  Fructose and mannose metabolism
cba00680  Methane metabolism
cba01100  Metabolic pathways
cba01110  Biosynthesis of secondary metabolites
cba01120  Microbial metabolism in diverse environments
cba01130  Biosynthesis of antibiotics
cba01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLB_0556
   00030 Pentose phosphate pathway
    CLB_0556
   00051 Fructose and mannose metabolism
    CLB_0556
  Energy metabolism
   00680 Methane metabolism
    CLB_0556
Enzymes [BR:cba01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CLB_0556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: ABS33693
UniProt: A7FRC9
Position
complement(583912..585918)
Genome map
AA seq 668 aa AA seqDB search
MTLYDENNLHIIKDNLRYLKLLSKQYPSISSASSEIINLQAILNLPKGTEHFISDVHGEY
ESFTHMLKNASGVIKRKIDDVFGTSLRECDKKNLATLIYYPEQKLDLIKKSEKNLEDWYK
ITLYRLIRLCQIVSSKYTRSKVRKSLPSDFAYIIEELLNEQGDRVDKQEYYNSIIETIID
IDRASEFIIAISNVIQRLVVDKLHIIGDIYDRGPGAEIIIEALSKHHSIDIQWGNHDIVW
MGAAAGCEACIANVIRISLRYANLSTLEDGYGINLLPLATFAMDFYKEDNCENFKPRTID
KNLNETDIKLLSKMHKAISIIQFKLEGKIIKRRPEFKMGERLLLDKINIKEGTLNLNEKI
YKLIDTNFPTLDKENPYELNERERDLVEKLTNSFINSEKLQRHIKFLYSNGNLYLKYNSN
LLYHGCIPLNEDGSLKEVTLCKETLKGKSLLDKLDRLAREAYFFKKDPESKLYGMDMMWY
LWCGSNSPLFGKKKMTTFERYFLDDKNTHKEQKNPYYKYRNDEKMCTMIFEEFELDADNS
HIINGHIPVKTKEGENPIKANGKLLVIDGGFCKAYQPQTGIAGYTLIYNSYGLLLTSHEP
FSSIHKAIVEGNDILSSTTILEHVSSRKRVLDTDSGEEIKKQIHDLEMLLVAYRKGLIKE
ENEANIRF
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgactttatatgatgagaacaacttacatataataaaagataatttaagatatttaaaa
ttattgtccaaacagtatcctagtatttcaagtgctagttcagaaattataaatcttcaa
gcaatattaaacctccctaagggaacagaacattttataagtgatgttcacggagagtat
gaatcttttactcatatgctaaaaaatgcatcaggagttattaaaagaaaaatagatgat
gtctttggaacttctttaagggaatgtgacaaaaaaaatttagctacactaatatactat
cctgaacaaaaattagatttaataaaaaaatctgaaaaaaacttagaagattggtacaaa
ataactttatatagattaataagactatgccaaatagtttcttctaaatatactagatct
aaagttagaaaatctctaccttctgattttgcttacattattgaagaattattaaatgaa
caaggtgatagagtagataagcaagaatattacaacagtataattgaaactattatagat
attgatagagcttctgaatttataattgctatatcaaatgttattcaaagattagtagta
gataagcttcatataataggagatatctatgatagaggtcctggagctgaaattataatc
gaagctttaagtaagcatcattctatagatatacaatggggtaatcatgacattgtatgg
atgggagctgctgcgggatgtgaagcttgtattgccaatgtaataagaatatctcttcgt
tatgctaatttatccacattagaagatggatatggtataaatttattaccattagctact
tttgctatggatttttataaagaagataattgtgaaaattttaaaccgagaactatagat
aaaaatttaaacgaaacagatattaaacttttatcaaaaatgcataaagctatatcaata
attcaatttaagttggaaggtaaaataatcaaaagaagacctgaatttaaaatgggagaa
agattattattagataaaataaatataaaagaaggtactttgaacctaaacgagaaaatt
tataaattaattgatactaactttcctacattagataaagaaaatccttatgaattaaat
gaacgagaacgagatttagtagaaaaacttacaaattcgtttattaatagtgaaaagtta
caaagacatataaaatttttgtatagtaatggaaatctttacctaaagtacaactctaat
ttactatatcatggttgtatacctttaaatgaggatggctccttaaaagaagtaactcta
tgcaaggaaaccttaaagggtaaatcccttctagacaaactagatcgtttagcaagagaa
gcttacttttttaagaaagatccagaatcaaaactatatggtatggacatgatgtggtat
ttatggtgtggttctaactctcctttatttggtaaaaaaaagatgaccacctttgaaaga
tatttcttagatgataagaatacacataaagaacaaaaaaatccttattataaatataga
aatgatgaaaaaatgtgcacaatgatatttgaagaatttgaactagatgctgataattcg
catataataaatggtcatattcctgtgaaaactaaagaaggcgaaaatcctataaaagct
aatggtaaactattagttatagatggtggtttttgtaaagcctatcagccacaaacgggt
attgcaggatatacattaatatataattcctatggattacttctaacctctcatgagccc
tttagttctatacacaaagctatagtagaaggaaatgatatactttcatctactacaata
ttagaacatgtatcctcacgaaaaagagtattagatacagatagtggtgaggagataaaa
aaacagatacatgatttagaaatgctattagttgcttacagaaaaggtcttataaaggaa
gaaaatgaagcaaatataagattttag

DBGET integrated database retrieval system