KEGG   Clostridium botulinum A ATCC 19397: CLB_0964Help
Entry
CLB_0964          CDS       T00574                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cba  Clostridium botulinum A ATCC 19397
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cba00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1002008..1002982
Genome map
AA seq 324 aa AA seqDB search
MFRRHRRLRENEAIRAMVRETVTREEDFIYPMFVVEGENIKEEISSLPGNYHYSIDRLEE
LVEEVKKSGIKGIMIFGVPDHKDECGSAAFDDNGIVQKGIRRLRELMPELYIVADVCMCQ
YTSHGHCGIIHGHNVDNDESLKYLAKISLSYAKAGADMIAPSDMMDGRVYAIRKILDENN
LKHVGIMAYSAKYCSAFYGPFREAANSAPQFGDRKTYQMDPANGREAMLEIEDDINEGAD
IVMVKPALPYLDVIRMAKDRFEFPLAAYNVSGEYAMVKAAAKQGLIDERRVALEMLTSIK
RAGADIIITYYAFEASAWLKEDRK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaagacacagaagattaagagagaatgaagcaataagagctatggtaagagaa
acagtgactagagaagaggattttatatatccaatgtttgtggtagaaggagaaaatatt
aaagaagaaatatcttcactaccaggaaattatcattattctatagatagattagaagaa
ttagtagaggaagtaaaaaaatcaggaataaaaggtataatgatatttggagtaccagat
cataaagatgaatgtggttccgcagcctttgatgataatggaatagttcaaaagggtata
agaagattaagagaattaatgccagaactatatatagttgcagatgtatgcatgtgccaa
tatacaagtcatggacattgtggaataatccatggtcataatgtggacaatgatgaatca
ttgaaatatttagcaaaaatatctttatcttatgcaaaagccggcgcagatatgatagca
ccttcagatatgatggatggaagagtttatgctataagaaaaatattagatgaaaataat
cttaaacatgtaggcataatggcatatagtgcaaaatattgttcagctttctatggtcct
ttcagagaagcagctaattcagcaccacaatttggagacagaaaaacttatcaaatggat
ccagcaaacggaagagaagcaatgcttgaaatagaagacgatataaatgaaggtgcagat
atagtaatggtaaaaccagctctgccatatttagatgttataagaatggcaaaggataga
tttgaattcccgttagcagcttacaatgtaagtggagaatatgctatggtaaaagcagca
gctaaacaaggattaatagatgaaagaagagtagccctagaaatgctaacatcaataaaa
agagcaggagcagatataataataacttattatgcatttgaagcaagtgcttggctaaaa
gaagacagaaaatag

DBGET integrated database retrieval system