KEGG   Clostridium botulinum A ATCC 19397: CLB_1171Help
Entry
CLB_1171          CDS       T00574                                 

Definition
pyrazinamidase/nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cba  Clostridium botulinum A ATCC 19397
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CLB_1171
Enzymes [BR:cba01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     CLB_1171
    3.5.1.-  
     CLB_1171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1221332..1221892
Genome map
AA seq 186 aa AA seqDB search
MFKSILIIDCQNDFISGSLACDNGEIAVKNIINLLNINKDLKVFYSLDWHSENNKSFKIN
GGIWPVHCVVNRFGAKLEESFYKELQHKNHSPNNKKILFSKGKNDHIEEYSAYEGENILG
NKINEVLDKDVIVCGIASEFCVKETVEDLIRNGFNVELYIDGVAYVNKKEHEKTLNNLRE
QGAKFI
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagtcaatacttataatagactgccaaaatgatttcatatcaggttcactggct
tgtgataatggagagatagctgttaaaaacattataaatttattaaatataaataaagat
ttaaaagtattttactctttagattggcatagtgaaaataataaatcttttaaaataaat
ggtggtatatggccagtacattgtgtagtcaatagatttggtgctaaactagaggagagt
ttttataaagaattacaacataaaaatcattcacctaataataaaaaaatattgttttca
aaaggaaaaaatgatcatatagaagaatattcagcctatgaaggagaaaatattttaggt
aataagattaatgaagtattagataaggatgtaattgtatgtggtatagcttctgagttt
tgtgttaaagaaacggtagaggacttaattagaaatggatttaatgtggaattatatata
gatggggtagcatatgtaaataaaaaagaacatgaaaaaactttaaataatttaagagag
cagggggctaaatttatttaa

DBGET integrated database retrieval system