KEGG   Clostridium botulinum A ATCC 19397: CLB_1932Help
Entry
CLB_1932          CDS       T00574                                 

Gene name
pfkB
Definition
(GenBank) 1-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
cba  Clostridium botulinum A ATCC 19397
Pathway
cba00010  Glycolysis / Gluconeogenesis
cba00030  Pentose phosphate pathway
cba00051  Fructose and mannose metabolism
cba00052  Galactose metabolism
cba00680  Methane metabolism
cba01100  Metabolic pathways
cba01110  Biosynthesis of secondary metabolites
cba01120  Microbial metabolism in diverse environments
cba01130  Biosynthesis of antibiotics
cba01200  Carbon metabolism
cba01230  Biosynthesis of amino acids
Module
cba_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLB_1932 (pfkB)
   00030 Pentose phosphate pathway
    CLB_1932 (pfkB)
   00051 Fructose and mannose metabolism
    CLB_1932 (pfkB)
   00052 Galactose metabolism
    CLB_1932 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    CLB_1932 (pfkB)
Enzymes [BR:cba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CLB_1932 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ABS33962
Position
complement(2058648..2059571)
Genome map
AA seq 307 aa AA seqDB search
MIYTLTTNPAIDMNCSSSSNEVFKVNRTNNLSYSPNGKGVNVSLVLNHYSIESKALGFFG
GFTGKYIVEELNKKNILTEAFWIEENTRINVFINTEDNKEFKYVNKGPFVSRETQKDLLK
YLSSNLKKGDYLIISGSLPQSIQEDYYNEILDICMENNVQVILDISSKKLKELLKYKPLL
IKPNDEEVEAIFGLSLKDEEDIKEALKYIYKLGAKNILLTLGEKGMYFYNGDKIYYCNAP
KIKLLSSACAGDSALAAFLSEWLYEANIEKALKKASATGANVAESSALGTFGKVSEYIKK
IHVKEVA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacattaactactaatccagctattgatatgaactgttcttccagtagtaat
gaagtttttaaggtaaatagaactaataatttatcttattcgcctaatggaaaaggagta
aacgtatcgctagttttaaatcattattctatagaaagcaaagctcttggatttttcgga
ggatttacaggaaagtatattgtagaggaattaaataagaaaaatatacttacagaagcc
ttttggatagaagaaaatacaaggataaatgtatttataaatacggaagataataaagaa
tttaagtatgtaaacaagggaccttttgtttcaagggaaacccaaaaggatttattaaaa
tacttatcatcaaatttaaaaaaaggtgattatttaataataagtggaagtcttccccaa
agtattcaagaggattactacaatgaaattttagatatatgtatggagaataatgttcaa
gttatattagatataagctctaaaaaattaaaagaattattgaaatataaacctttatta
attaaacctaatgatgaagaagttgaggcaatatttggtctaagtttaaaagatgaagag
gatataaaagaggcattaaaatatatttataagttaggtgctaaaaatatacttctgacc
ttaggggagaaaggaatgtatttttacaatggagacaagatttattattgcaatgcacct
aaaattaaacttttaagctctgcttgtgcaggggactcggccttagcagcatttttaagt
gaatggttatatgaagctaatatagaaaaggcacttaaaaaggcatcagccactggtgca
aatgttgctgaatctagtgcattaggaacttttggtaaagtatcagagtatataaaaaaa
atacatgttaaggaggtagcgtaa

DBGET integrated database retrieval system