KEGG   Clostridium botulinum A ATCC 19397: CLB_1932Help
Entry
CLB_1932          CDS       T00574                                 

Definition
PfkB family kinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
cba  Clostridium botulinum A ATCC 19397
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLB_1932
   01230 Biosynthesis of amino acids
    CLB_1932
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLB_1932
   00030 Pentose phosphate pathway
    CLB_1932
   00051 Fructose and mannose metabolism
    CLB_1932
   00052 Galactose metabolism
    CLB_1932
  Energy metabolism
   00680 Methane metabolism
    CLB_1932
Enzymes [BR:cba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CLB_1932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2058648..2059571)
Genome map
AA seq 307 aa AA seqDB search
MIYTLTTNPAIDMNCSSSSNEVFKVNRTNNLSYSPNGKGVNVSLVLNHYSIESKALGFFG
GFTGKYIVEELNKKNILTEAFWIEENTRINVFINTEDNKEFKYVNKGPFVSRETQKDLLK
YLSSNLKKGDYLIISGSLPQSIQEDYYNEILDICMENNVQVILDISSKKLKELLKYKPLL
IKPNDEEVEAIFGLSLKDEEDIKEALKYIYKLGAKNILLTLGEKGMYFYNGDKIYYCNAP
KIKLLSSACAGDSALAAFLSEWLYEANIEKALKKASATGANVAESSALGTFGKVSEYIKK
IHVKEVA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacattaactactaatccagctattgatatgaactgttcttccagtagtaat
gaagtttttaaggtaaatagaactaataatttatcttattcgcctaatggaaaaggagta
aacgtatcgctagttttaaatcattattctatagaaagcaaagctcttggatttttcgga
ggatttacaggaaagtatattgtagaggaattaaataagaaaaatatacttacagaagcc
ttttggatagaagaaaatacaaggataaatgtatttataaatacggaagataataaagaa
tttaagtatgtaaacaagggaccttttgtttcaagggaaacccaaaaggatttattaaaa
tacttatcatcaaatttaaaaaaaggtgattatttaataataagtggaagtcttccccaa
agtattcaagaggattactacaatgaaattttagatatatgtatggagaataatgttcaa
gttatattagatataagctctaaaaaattaaaagaattattgaaatataaacctttatta
attaaacctaatgatgaagaagttgaggcaatatttggtctaagtttaaaagatgaagag
gatataaaagaggcattaaaatatatttataagttaggtgctaaaaatatacttctgacc
ttaggggagaaaggaatgtatttttacaatggagacaagatttattattgcaatgcacct
aaaattaaacttttaagctctgcttgtgcaggggactcggccttagcagcatttttaagt
gaatggttatatgaagctaatatagaaaaggcacttaaaaaggcatcagccactggtgca
aatgttgctgaatctagtgcattaggaacttttggtaaagtatcagagtatataaaaaaa
atacatgttaaggaggtagcgtaa

DBGET integrated database retrieval system