KEGG   Clostridium botulinum A ATCC 19397: CLB_2290Help
Entry
CLB_2290          CDS       T00574                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cba  Clostridium botulinum A ATCC 19397
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cba00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2432213..2433370)
Genome map
AA seq 385 aa AA seqDB search
MKNITILGATGSIGTQTLDVIRREKEELKLVAISANKSDKKVIEIIKEFKPKYAVLMEEN
AFKIVEDFCIDNKIDTKVLKGMEGMIYISTLEEVNTVVTSVVGMIGLVPTIKAIESGKDI
ALANKETLVVAGELVISKAKEHNVNILPVDSEHGAIFQCLRGNKKEEVKNIIVTASGGPF
RGKKKEELIDVKPEHALKHPKWNMGRKISIDSATLMNKGLEVIEAHFLFGVDYENIKVVV
HPQSIVHSMVEYKDGSVIAQMATPDMKLPIQYALNYPNRKESQIEPLDFYKISNLTFEKP
DMDTFLPLKLAYEAGKKGGVMPAILNGANEVAVDLFLKGKIEFLQIGDLLQECMNKFYKS
MEATLENVISVDKEVREYLGKKYDI
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaacattaccatattaggcgcaacaggctctattggaacccaaactttagatgta
ataagaagagaaaaggaagaattaaaattagtagccatatccgcgaataaaagcgataaa
aaagttatagaaattataaaggaatttaaacctaaatatgcggttttaatggaagagaat
gcttttaaaatagtagaagatttttgtatagataataaaatagatacaaaagttttaaaa
ggtatggaaggaatgatatatataagcaccttagaggaggtaaatacagtagttacctct
gtggtaggaatgataggattagttccaaccataaaagctatagaaagtggaaaagatata
gctttagctaacaaagaaaccttagtagtagctggagaactagttattagtaaagctaaa
gagcataatgtaaatatattacctgtagattcagaacacggagctatttttcaatgttta
agaggaaataaaaaggaagaagttaaaaatataatagtaacagcttcaggaggacctttt
agaggtaaaaagaaggaagaactcatagatgtaaagccagagcatgctcttaaacatcct
aaatggaatatgggaagaaaaatatctatagattctgccacattaatgaataaagggtta
gaggttatagaagctcactttttatttggtgtggattatgaaaatataaaggtggtggta
catccacaaagtatagtccattctatggtagaatataaagatggaagtgtaatagcacaa
atggcaactccagatatgaaattacctatacaatatgctttgaattatcctaataggaaa
gaaagtcaaatagaacctttagatttttataaaatatctaatttaacctttgaaaaaccg
gatatggatacattcttaccactaaagttggcttatgaagcagggaaaaaaggtggagta
atgccagccatattaaatggggccaatgaggttgcagtagatttatttttaaagggcaaa
atagaatttttacaaataggtgacctattacaagaatgtatgaataaattttataaatct
atggaagctacattagagaatgtaataagtgtagataaggaagttagagagtatttaggt
aaaaaatatgatatataa

DBGET integrated database retrieval system