KEGG   Clostridium botulinum A ATCC 19397: CLB_2647Help
Entry
CLB_2647          CDS       T00574                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cba  Clostridium botulinum A ATCC 19397
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cba00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CLB_2647
Enzymes [BR:cba01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CLB_2647
Peptidases [BR:cba01002]
 Cysteine Peptidases
  Family C44
   CLB_2647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2766212..2768209)
Genome map
AA seq 665 aa AA seqDB search
MSILVVEKNNDRLNGLTEGKKYHYEQCNLNDTSIKFLNDNTLYRPEENLVNNEDKMIEVF
ILGDVYTTSNENRCKEDIIWLYKKFGEKSLENINGRFILCLIDRNKDTVYIVNDRYGSIN
FYYNIDDKGFLFSNKAEVMLNNIKSRIIDEESIKDYIKYGCLKNNRTLLKNVKRFQAASM
VKITKKYIGIKQYWDWNIKKKENISFNESVEKLGELWIEAVRKTLNKHKKFNITVTGGLD
SRAIVAAIDYLRLNHKINLSYTIGIKGCLEEKIARQVAEKAGFKYKFFEIDNKKYLQNCK
KALKRSICALNGNFACINILDNEEIYKYPILSGTFGGESIGGDLLINNISYSFKEEVYNY
INNLQARIYGVNDSMLLKKNDALNKNCFDKNSQEYLHSDFYIFNEYLIRNRTAVLYEMMG
DNYKCITPFLDNDFLNYLYSLPEKWRKNHYIYNMMLLKFFPKFYLDIPWERTNLPIIAEL
DEKYIERYIEKYSLNIVKNLNIKNKDVVLFGASTLGVKAYKLLKWNYNILSFCDNDDKKW
NTKFCGVKVISPKELVNMRKVSIVIASMYYEEILKQLKLLNIEDVSVFGYKDRNDTSTDF
NKWIKDDNVYSLIKNEISENQYINEYINANYLVEKFDKYIDSKEGVKIIMLTTSLNQVLK
NVMKK
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtctattttagttgtagaaaaaaataatgatagattaaatggtttaactgaagggaaa
aaatatcattatgaacaatgtaatttaaatgatactagtattaagtttttaaatgataat
actttatatagaccagaagaaaatctagttaataatgaagataaaatgattgaagtattt
atattaggagatgtttatactacctctaacgagaacaggtgtaaggaagatataatatgg
ttatataaaaagtttggagaaaaatcactggaaaatattaatggtaggtttatattatgt
ttaattgacagaaataaagatacagtttacatagtaaatgataggtatggttctataaat
ttttattataacatagatgataaaggatttttgtttagtaataaagcagaagtaatgcta
aataatataaaaagcaggattattgatgaggaaagtataaaagattatataaaatatgga
tgcttaaaaaataatagaaccttattaaaaaatgtgaagaggtttcaagcagctagtatg
gtaaaaattacaaagaagtatattggaattaaacaatattgggattggaacataaagaaa
aaagaaaatattagttttaatgaatctgtagaaaaattaggggaactatggattgaagct
gtaagaaaaacattaaataaacataagaaatttaacattactgttacaggggggctagac
tcaagagctattgtagcagcaattgattacttaagattaaatcacaaaattaatttatcc
tatactattggtataaaaggttgtttagaagaaaagatagctagacaagtagcagaaaaa
gctggttttaaatataagttttttgaaatagataacaaaaaatatctacagaactgtaaa
aaggctttaaaaagatctatatgtgctctaaatggaaattttgcttgtataaatatccta
gataatgaagagatatataagtatcctattctttcaggaacttttggaggagaaagtata
ggaggagatttactaataaataatataagttatagttttaaagaggaagtttataattac
ataaataatttgcaagctagaatatatggtgtaaatgatagtatgctattgaaaaaaaat
gatgctttaaataaaaattgttttgataaaaattcacaggaatatttacactctgatttt
tatatattcaatgaatatttgataagaaatagaactgctgttttgtatgaaatgatgggg
gataattataagtgtataacaccctttttagataatgattttttaaattatttatactct
cttccagagaaatggagaaaaaaccattatatatataatatgatgttattaaaatttttc
cctaagttttatttagatataccatgggaaagaactaatctgccgattatagcagaactt
gatgaaaaatatatagaaagatatatagaaaaatattctttaaatatagtaaaaaattta
aatattaaaaataaggatgtagttttattcggagcatctactttaggagtaaaggcttac
aagttgttaaagtggaattataacatattatctttttgtgataatgatgataaaaaatgg
aacacaaaattctgtggagttaaagtaatatctccaaaagaattagtgaatatgagaaaa
gtgtccatagttattgcaagcatgtactatgaagaaatacttaaacaattaaagttatta
aacattgaagatgtatctgtatttgggtataaagatagaaatgatacatctacggatttt
aataaatggatcaaagatgataatgtttatagtttaattaaaaatgaaataagtgaaaac
cagtatataaatgaatacataaatgcaaactatttagtggaaaaatttgacaagtatata
gatagtaaagaaggtgttaaaattattatgttaactacttctttaaatcaagtactaaaa
aatgttatgaaaaaataa

DBGET integrated database retrieval system