KEGG   Clostridium botulinum B1 Okra: CLD_0547Help
Entry
CLD_0547          CDS       T00671                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cbb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLD_0547 (tpiA)
   01230 Biosynthesis of amino acids
    CLD_0547 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLD_0547 (tpiA)
   00051 Fructose and mannose metabolism
    CLD_0547 (tpiA)
   00562 Inositol phosphate metabolism
    CLD_0547 (tpiA)
Enzymes [BR:cbb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CLD_0547 (tpiA)
Exosome [BR:cbb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CLD_0547 (tpiA)
  Exosomal proteins of bladder cancer cells
   CLD_0547 (tpiA)
  Exosomal proteins of melanoma cells
   CLD_0547 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
273782..274528
Genome map
AA seq 248 aa AA seqDB search
MRTAIIAGNWKMNKTVKEAVELVKELKPLVKDAKCDVVVCPTYVCLPAVLEEVKGSNIKV
GAQNMHFEESGAYTGEIAPKMLEELGVHYVIIGHSERRQYFNETDETVNKKVKKAFEHNL
IPIVCCGESLEEREGNITEKVLEGQIKVGLKELSKEQVEKLVIAYEPIWAIGTGKTATDE
QANETIGYIRTVVKDMYGESVADKVRIQYGGSVKPGTIKAQMAKEEIDGALVGGASLKAK
DFAAIVNY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaacagccataatagcaggaaactggaaaatgaacaaaactgtaaaagaagcagta
gaattggttaaagaattaaaaccacttgttaaagatgcaaaatgtgatgtagttgtatgt
cctacttatgtatgccttccagcggtattagaagaagttaaaggaagtaatataaaagta
ggtgctcaaaatatgcactttgaagaaagtggagcttatacaggtgaaatagcacctaaa
atgttagaagaactaggagttcattatgtaattataggacatagtgaaagaagacaatac
tttaatgaaacagatgaaactgtaaacaaaaaagtaaaaaaagcctttgaacataattta
attccaatagtttgttgtggagaaagcttagaagaaagagaaggaaacataacagaaaaa
gttttagaaggacaaataaaagttggattaaaagaattaagcaaagaacaagtagaaaaa
ttagttatagcatatgaaccaatttgggctataggaacaggaaaaactgctacagatgaa
caagcaaatgaaactataggatatataagaactgtagtaaaagatatgtatggtgagagt
gttgcagataaagtaaggattcaatacggtggatctgttaagcctggcactatcaaagct
caaatggctaaagaagagattgatggtgcattagtagggggcgcaagcctaaaagcaaaa
gattttgctgctatagtaaattattaa

DBGET integrated database retrieval system