KEGG   Clostridium botulinum B1 Okra: CLD_0611Help
Entry
CLD_0611          CDS       T00671                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cbb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CLD_0611
Enzymes [BR:cbb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CLD_0611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
202682..204916
Genome map
AA seq 744 aa AA seqDB search
MQEIQGFIEDILFKNDENGYVVAKIRKKKELITIVGCMPYITEGQNLKLKGEWVIHPQFG
NQFKVEICEEIVPDTVAGIERYLSSGIISGIGPVTAKKIVKKFGEETLNILDNNIERLTE
IEGIGKKKIEIIYDSYIKQNEVRNIMMFFQNYGVTPNQCMKVYKRFGENSISIVKENPYI
LTEEIRGIGFKTADKIARSLGIASNSPFRIQSGINYIINGFCSLGNTYMPLEKLISEAMD
ILGVREEEIHENIYNNVAENKLKIEKVKEESCVFTLPYYYCELGVTKKILSLSLSQYDNL
NINIEDEIVSFEKNNNIKFHDSQREAIKGALENGVEIITGGPGTGKTTIINCITEIFEKA
NMKVYMAAPTGRAAKRMSETTGREAKTIHRMLEMGVSEDDTEEVFSKGEETPLECDVVII
DEASMIDIILMNTLLKAIALGTRIIIVGDVDQLPSVGPGNVLRDLIESKCVKVVRLKEIF
RQSKESMIIVNAHRINDGEMPIINKKDKDFYFIECSEPKKIVNTLLELSNRRLPKFNKSW
HKIHDIQILSPMRKGVLGVSSLNKELQSVLNPKNDSKKEMEFKDYIFRVGDKVMQTKNNY
SLKWTRASGEGEAEGLGIFNGDVGYIEDIDEEKETIQVLFDNERRVIYENLYLDEIDLAY
AVTIHKSQGSEFPVVIMPAFKGPPLLMNRNLLYTGITRAKRLVVLVGSLKAINFMVQNDK
IFERYSLLKWRISNILDTEIINGE
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaatacagggatttatagaggatatactttttaaaaatgatgaaaatggatat
gtagtagcaaaaataagaaagaagaaagaacttataaccatagtgggatgtatgccctac
ataacagaaggacaaaacttaaaattaaaaggtgaatgggtaattcatccacaatttggt
aatcaattcaaagtagaaatatgtgaagaaatagtacccgatactgtagctggtatagaa
agatatttatcctcaggaatcatatcaggtataggcccagtgactgcaaaaaaaattgtg
aaaaaatttggagaagaaacattaaatatattagacaataatatagaaagattaacagag
atagagggaataggaaagaagaagatagaaataatatatgattcctatataaaacaaaat
gaagtgcgaaatataatgatgttttttcaaaattacggagttacacctaatcaatgcatg
aaagtttataaaagatttggagaaaattctatatcaatagttaaagagaatccatatata
cttacagaagaaataagaggaataggtttcaagacagcagataaaatagctaggagctta
ggaatagcctctaattcaccttttagaattcagagtggaataaattatataataaatgga
ttctgtagtttaggaaatacttatatgcctttagagaagcttataagtgaggctatggat
atattaggggtaagagaagaagaaatacatgaaaatatatacaataatgtagcagaaaat
aaattaaagatagaaaaagtaaaagaggaaagttgtgtttttactctaccgtattattat
tgcgaattaggagttacaaaaaaaatacttagtttatctttgtcacaatatgataattta
aatataaatatagaagacgagatagtgagttttgaaaaaaataataatataaaatttcat
gattctcaaagagaggctataaaaggtgccttagaaaatggagtagaaataataacagga
ggccctggtacaggaaaaacaactattattaattgtataacagagatatttgaaaaagct
aatatgaaagtttatatggcagcacctacaggaagagcggctaaaagaatgtctgaaact
acaggtagagaagctaaaacaatacataggatgttagaaatgggtgtatctgaggatgac
acagaagaagttttttctaaaggtgaagaaactcctttagaatgtgatgtagtaataata
gatgaagcttccatgatagatataatattaatgaatacactgttaaaggccatagcttta
ggtacaagaataataatagttggggatgtagatcaacttccttcagtaggtccagggaat
gtattaagagatttaatagaaagtaagtgtgtaaaggtagttagattaaaggagatattc
agacaatctaaagaaagtatgattatagtaaatgcccatagaataaatgatggagagatg
ccaattataaataaaaaagataaagatttttattttatagaatgtagtgaacctaaaaaa
atagttaatacattattagaactttcaaatagaagattgcctaaatttaataaaagttgg
cataaaattcatgatatacaaatactatctccaatgagaaagggagttctaggagtttct
agtttaaataaggaattacaatctgttttaaaccctaaaaatgattcaaaaaaagaaatg
gaatttaaggattatatatttagagtaggagataaagttatgcaaaccaaaaataactac
tctttaaagtggaccagagcaagtggtgagggggaagcagaagggttaggaatatttaat
ggagatgtaggatatatagaggatatagatgaggaaaaagaaacaattcaggtcttattt
gataatgaaagaagagtaatatatgaaaatttatatttagatgaaatagatttagcttat
gctgtaactattcataaaagtcaaggtagcgaatttccagtagtaattatgccagctttt
aaaggtcccccgcttttaatgaatagaaatttattgtatacaggaataacaagagcaaaa
aggcttgttgtcttggtaggatctttaaaagctattaattttatggtacagaatgataaa
atttttgaaagatactctcttttgaagtggcgtataagtaatattttagatactgaaatt
ataaatggagaataa

DBGET integrated database retrieval system