KEGG   Clostridium botulinum B1 Okra: CLD_0918Help
Entry
CLD_0918          CDS       T00671                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cbb00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cbb00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
3883042..3884295
Genome map
AA seq 417 aa AA seqDB search
MSKLKITGGNPLFGKVEISGAKNAAVAILPATIMASKGVCTIENTPNIEDVHCIERILNG
LGCEIKRQSNSILQIDSTNITKTDANTEDVRKMRASYYLIGALLGRFKKARVELPGGCPI
GVRPIDQHIKGFEALGAHVEIEHGAVIVKADKLIGTNIFFDVVSVGATINVMLAATLAEG
NTVLENVAKEPHVVDVANFLNSMGANIKGAGTDIIRVTGVKELKGCTYSVIPDQIEAGTY
MIATAACGGEVTINNVIPKHLESITAKLIEMGVDVIENGDSVTIKSKGNFKGANIKTQPY
PGFPTDVQQPMSTLLTIAKGRSIVNESIWESRFKHVDELKKMGANIKVEGRTAIIDGVPK
LTGAIVKATDLRAGAAMVIAGLLAEGDTEILGVEHIDRGYPNIENKFRSLGATIVRL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattaaaaataacaggaggtaaccccctctttggaaaagttgaaattagtgga
gcaaaaaatgcagcagtagctatattaccagctactattatggctagcaaaggagtttgt
actatagagaatactccaaatattgaagatgtacattgtattgaaagaattttaaatgga
ttgggttgcgaaattaaaagacaaagcaattctattttacaaatagatagtactaatata
acaaaaacagatgctaatactgaagatgtaagaaaaatgagagcttcttattatcttatc
ggagctttattaggaaggtttaaaaaagctagagtagaattacctggtggatgtcctata
ggtgttagacctatagatcaacacattaaaggttttgaagctttaggagctcatgtcgaa
atagaacatggtgctgtaattgtcaaagcagataaattaataggaactaatatatttttt
gacgttgttagcgtaggcgctactataaatgtgatgttagctgccacacttgctgaaggc
aatactgtgctagaaaatgtagcaaaggaacctcacgtagtagatgtagctaatttttta
aatagtatgggagctaatatcaaaggtgctggaacagacattataagagttactggtgtt
aaagaattaaaaggctgtacttatagtgtaatacctgatcaaattgaagctggtacatat
atgatagcaacagctgcctgcggtggagaagttacaataaataacgtaatacctaaacac
ttagaatctataacagcaaaacttatagaaatgggagtagatgttatagaaaatggagat
tctgttacaataaaatctaaaggtaattttaaaggcgctaatataaaaactcagccttac
ccaggatttccaacggatgtgcaacaaccaatgagcacacttttaactattgcaaaagga
agaagtattgtaaatgaaagcatttgggaaagtagatttaaacatgtagatgaattgaag
aaaatgggagcaaatattaaggtagaaggtagaacagccattatagatggtgtacctaaa
cttacaggagctatagtaaaagctacggatttgagagctggggctgctatggtaattgct
ggattattagctgaaggtgataccgaaattcttggtgtggagcatatagatagaggatac
ccaaatattgaaaataaatttagatctttaggggctactatagttagactatag

DBGET integrated database retrieval system