KEGG   Clostridium botulinum B1 Okra: CLD_1290Help
Entry
CLD_1290          CDS       T00671                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cbb00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cbb00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(3519281..3520204)
Genome map
AA seq 307 aa AA seqDB search
MLKGRNLLDPMDFSLEELEEVFKLADEIIEEPEKFLHVCDGKILATLFYEPSTRTRFSFE
AAMLRLGGQVIGFSEPNSSSVAKGESVADTIRTVGCYADIAAMRHPKEGAPAIAAMYSEI
PVINAGDGSHQHPTQTLTDLLTIRSLKGDLSNLTIGCCGDLKFGRTVHSLVKALSRYKNN
KFVFMSPEELKIPDYIRKEILEKNNIEYKEVSKMEDAMAELDILYMTRVQRERFFNEDDY
VRLKDSYILDGEKMRYAKKDMMVLHPLPRVNEIAYEIDQDPRGCYFKQAKYGMYVRMALI
AKLLGVR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaggaagaaatttattagacccaatggatttttcattagaagaactagaagag
gtatttaaattagcagatgaaataattgaggagccggaaaaatttttacatgtatgtgat
ggaaaaatattagctacattattctacgagccaagtacaagaacaagatttagttttgaa
gctgctatgcttagactaggtggtcaggtaataggattttcagagcctaattcaagttca
gtagcaaaaggagaaagtgtggcagacactataagaactgtaggttgttatgcagatata
gcagccatgagacacccaaaagaaggtgcaccggcaatagctgcaatgtattcagaaata
ccagttataaatgctggtgatggtagtcatcaacatccaactcaaacattaacagatcta
ttaactataagatccttaaaaggagatttatctaacttaactataggttgctgtggagat
ttaaaatttggaagaacagtacactcattagtaaaggccctatcaaggtataagaacaac
aaatttgtttttatgtcaccagaagaattaaaaattcctgattatataagaaaagaaata
ttagaaaaaaacaatatagaatataaagaagtatcaaagatggaagatgcaatggcagaa
ctagatatactttatatgacaagagttcaaagagaaagattctttaatgaagatgattat
gtaagattaaaggatagctatatattagatggtgaaaagatgagatatgccaaaaaagat
atgatggttcttcatccattaccaagagttaatgaaatagcttatgaaatagatcaagac
ccaagaggatgttattttaaacaagctaaatatggaatgtatgtaagaatggctttaata
gcaaaattattgggggttagataa

DBGET integrated database retrieval system