KEGG   Clostridium botulinum B1 Okra: CLD_2632Help
Entry
CLD_2632          CDS       T00671                                 

Gene name
pfkB
Definition
(GenBank) 1-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
cbb00010  Glycolysis / Gluconeogenesis
cbb00030  Pentose phosphate pathway
cbb00051  Fructose and mannose metabolism
cbb00052  Galactose metabolism
cbb00680  Methane metabolism
cbb01100  Metabolic pathways
cbb01110  Biosynthesis of secondary metabolites
cbb01120  Microbial metabolism in diverse environments
cbb01130  Biosynthesis of antibiotics
cbb01200  Carbon metabolism
cbb01230  Biosynthesis of amino acids
Module
cbb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cbb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLD_2632 (pfkB)
   00030 Pentose phosphate pathway
    CLD_2632 (pfkB)
   00051 Fructose and mannose metabolism
    CLD_2632 (pfkB)
   00052 Galactose metabolism
    CLD_2632 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    CLD_2632 (pfkB)
Enzymes [BR:cbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CLD_2632 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ACA46806
UniProt: B1IN87
Position
complement(2137985..2138908)
Genome map
AA seq 307 aa AA seqDB search
MIYTLTTNPAIDMNCSSSSNEAFKVNRTNNLSYSPNGKGVNVSLVLNHYSIESKALGFFG
GFTGKYIVEELNKKNILTEAFWIEENTRINVFINTEDNKEFKYVNKGPFVSRDTQKDLLK
YLSSNFKKGDYLIISGSLPQSIQEDYYNEILDICMENNVQVILDISSKKLKELLKYKPLL
IKPNDEEVEAIFGLSLKDEEDIKEALKYIYKLGAKNILLTLGEKGMYFYNGDKIYYCNAP
KIKLLSSACAGDSALAAFLSEWLYESNIEKALKKASATGANVAESSALGTFGKVSEYIKK
IHVKEVV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacattaactactaatccagctattgatatgaactgctcttccagtagtaat
gaagcttttaaggtaaatagaaccaataatttatcttattcacctaatggaaaaggagta
aacgtatcactagttttaaatcattattctatagagagtaaagctcttggatttttcgga
ggatttacaggaaagtatattgtagaggaattaaataagaaaaatatacttacagaagcc
ttttggatagaagaaaatacaaggataaatgtatttataaatacggaagataataaagaa
tttaagtatgtaaacaagggaccttttgtttcaagggatacccaaaaggatctattaaaa
tacttatcatcaaattttaaaaaaggtgattatttaataataagtggaagtcttcctcaa
agtattcaagaggattactacaatgaaattttagatatatgtatggaaaataatgttcaa
gttatattagatataagctctaaaaaattaaaagaattattgaaatataaacctttatta
attaaacctaatgatgaagaagttgaggctatatttggactaagtttaaaagatgaagag
gatataaaagaggcattaaaatatatttataagttaggtgctaaaaatatacttctaacc
ttaggggagaaaggaatgtatttttacaatggagacaagatttattattgcaatgcacct
aaaattaaacttttaagctctgcttgtgcaggggactcggccttagcagcatttttaagt
gaatggttatatgaatctaatatagaaaaggcacttaaaaaggcatcagccactggtgca
aatgttgctgaatcaagtgcattaggaacttttggtaaagtatcggagtatataaaaaaa
atacatgttaaggaggtagtgtaa

DBGET integrated database retrieval system