KEGG   Clostridium botulinum B1 Okra: CLD_2688Help
Entry
CLD_2688          CDS       T00671                                 

Gene name
aor
Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cbb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLD_2688 (aor)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CLD_2688 (aor)
Enzymes [BR:cbb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     CLD_2688 (aor)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(2069163..2070980)
Genome map
AA seq 605 aa AA seqDB search
MYGYNGKILRIDLTNRNCTLEPLDEEKAKKFIGARGLGVKTLLEEIDPKIDPLSIENKLV
IVTGPITGAPMPTSGRYMVVTKAPLTGTIAISNSGGKWGTELKNAGYDMIIVQGKSEVPV
YVNIEDDKIEIKEAEHLWGKTSLETTKILCNENNERAKVLCIGPAGEKLSLMAAIMNDID
RAAGRGGVGAVMGSKNLKAIVVKGSGKVKVVNEEEAKKVSLEKIKILREDPVAGGGLPTY
GSAVLVNIINENGVHPVRNFQKSYTDEADKISGETLTEDCLVRKNPCYRCPIACGRWVKL
DDGTECGGPEYETLWSFGSDCDVYDLNAINVANMLCNEYGLDTISAGATIAAAMELYEKG
YIKDEDIKEDGLSLKWGDAEAVVGWTKKMALREGFGDKMADGSYRLCESYGVPEFSMTVK
KQELPAYDPRGIQGHGITYAVNNRGGCHIKGYMISPEILGYPEKLDRFSLEGKAAYAKVF
HDLTAVIDSLGLCIFTTFGLGVQDYVDMYNVVVGGKLHDTESIMEAGDRIWTLEKLFNLE
AGIDSSHDTLPKRLLKEPIPEGPSKGCVHKLSELLPEYYAVRGWDKNGMPTKDTLKKLGL
EEYIK
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtatggttataatggaaagattttaagaattgatttaacaaatagaaattgtacttta
gagcctttagatgaagaaaaggccaaaaagtttataggagctagaggacttggggttaag
actttattagaagaaatagaccctaaaatagatccattgtctattgaaaataaacttgtt
atagttacaggtcctattactggagctcctatgccaaccagtggtagatatatggtagta
acaaaggctcctttgactgggactattgcaatatcaaactctggtggaaaatggggaaca
gaacttaaaaatgcaggatacgatatgataatagtacaaggtaaatcagaggtacctgtt
tatgtaaacatagaagatgataaaatagaaataaaagaagcagagcatctatggggtaag
acttcattagaaactacaaaaattctttgtaatgagaacaatgaaagagcaaaagtatta
tgtataggacccgcaggggaaaaactatctcttatggcagctattatgaatgatatagat
agagcagcaggaagaggtggcgttggagctgtaatgggttcaaagaatttaaaagccata
gtggttaaaggttctggaaaagttaaagtagtcaatgaggaggaagcaaaaaaagtatcc
ttagaaaaaattaaaatattaagagaagatccagtggcaggtggaggactacctacttat
ggttctgctgtacttgtaaatataattaatgaaaatggtgtacatcccgtgagaaatttc
caaaaatcttatacagatgaggctgataaaataagtggagaaacccttacagaggattgt
cttgtaagaaaaaatccatgttatagatgtccaatagcctgcggtagatgggtaaaatta
gatgatggcacagaatgtggaggcccagaatatgaaactttatggtcctttggatctgat
tgtgatgtatatgatctaaatgctattaatgtagctaatatgctttgtaatgaatatggt
cttgatacaatttcagcaggagcaactattgcagcagccatggagttatacgaaaaagga
tatataaaggatgaggatataaaagaggatggattatctttaaaatggggagatgcagag
gctgttgttggatggacaaagaaaatggcattaagagaaggttttggagataagatggca
gatggatcctatagattatgtgaatcctacggtgttccagagttttctatgacagttaaa
aagcaagaactaccggcctatgatccaagaggaattcaaggacatggtataacttatgca
gttaataatagaggtggttgtcatataaaaggttatatgataagtccggaaatactagga
tatccagaaaaacttgacagattctctctagaaggaaaggcagcctatgctaaagtattc
cacgatttgacagcagtaatagattctttagggttgtgtatatttacaacttttggactt
ggcgtacaggattatgtagatatgtataatgtagttgtaggtggtaagctacatgataca
gaatctataatggaagcaggagatagaatttggacattagaaaagttatttaatttagaa
gctggtatagacagttctcatgatactcttccaaaaagattacttaaagaacctattcca
gagggaccttctaagggatgtgttcataaattaagtgaattacttccagaatactatgca
gtaagaggatgggacaagaatggtatgccaacaaaagatacattgaaaaaattaggcctt
gaagaatatataaagtag

DBGET integrated database retrieval system