KEGG   Clostridium botulinum B1 Okra: CLD_2688Help
Entry
CLD_2688          CDS       T00671                                 

Gene name
aor
Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cbb01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cbb00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(2069163..2070980)
Genome map
AA seq 605 aa AA seqDB search
MYGYNGKILRIDLTNRNCTLEPLDEEKAKKFIGARGLGVKTLLEEIDPKIDPLSIENKLV
IVTGPITGAPMPTSGRYMVVTKAPLTGTIAISNSGGKWGTELKNAGYDMIIVQGKSEVPV
YVNIEDDKIEIKEAEHLWGKTSLETTKILCNENNERAKVLCIGPAGEKLSLMAAIMNDID
RAAGRGGVGAVMGSKNLKAIVVKGSGKVKVVNEEEAKKVSLEKIKILREDPVAGGGLPTY
GSAVLVNIINENGVHPVRNFQKSYTDEADKISGETLTEDCLVRKNPCYRCPIACGRWVKL
DDGTECGGPEYETLWSFGSDCDVYDLNAINVANMLCNEYGLDTISAGATIAAAMELYEKG
YIKDEDIKEDGLSLKWGDAEAVVGWTKKMALREGFGDKMADGSYRLCESYGVPEFSMTVK
KQELPAYDPRGIQGHGITYAVNNRGGCHIKGYMISPEILGYPEKLDRFSLEGKAAYAKVF
HDLTAVIDSLGLCIFTTFGLGVQDYVDMYNVVVGGKLHDTESIMEAGDRIWTLEKLFNLE
AGIDSSHDTLPKRLLKEPIPEGPSKGCVHKLSELLPEYYAVRGWDKNGMPTKDTLKKLGL
EEYIK
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtatggttataatggaaagattttaagaattgatttaacaaatagaaattgtacttta
gagcctttagatgaagaaaaggccaaaaagtttataggagctagaggacttggggttaag
actttattagaagaaatagaccctaaaatagatccattgtctattgaaaataaacttgtt
atagttacaggtcctattactggagctcctatgccaaccagtggtagatatatggtagta
acaaaggctcctttgactgggactattgcaatatcaaactctggtggaaaatggggaaca
gaacttaaaaatgcaggatacgatatgataatagtacaaggtaaatcagaggtacctgtt
tatgtaaacatagaagatgataaaatagaaataaaagaagcagagcatctatggggtaag
acttcattagaaactacaaaaattctttgtaatgagaacaatgaaagagcaaaagtatta
tgtataggacccgcaggggaaaaactatctcttatggcagctattatgaatgatatagat
agagcagcaggaagaggtggcgttggagctgtaatgggttcaaagaatttaaaagccata
gtggttaaaggttctggaaaagttaaagtagtcaatgaggaggaagcaaaaaaagtatcc
ttagaaaaaattaaaatattaagagaagatccagtggcaggtggaggactacctacttat
ggttctgctgtacttgtaaatataattaatgaaaatggtgtacatcccgtgagaaatttc
caaaaatcttatacagatgaggctgataaaataagtggagaaacccttacagaggattgt
cttgtaagaaaaaatccatgttatagatgtccaatagcctgcggtagatgggtaaaatta
gatgatggcacagaatgtggaggcccagaatatgaaactttatggtcctttggatctgat
tgtgatgtatatgatctaaatgctattaatgtagctaatatgctttgtaatgaatatggt
cttgatacaatttcagcaggagcaactattgcagcagccatggagttatacgaaaaagga
tatataaaggatgaggatataaaagaggatggattatctttaaaatggggagatgcagag
gctgttgttggatggacaaagaaaatggcattaagagaaggttttggagataagatggca
gatggatcctatagattatgtgaatcctacggtgttccagagttttctatgacagttaaa
aagcaagaactaccggcctatgatccaagaggaattcaaggacatggtataacttatgca
gttaataatagaggtggttgtcatataaaaggttatatgataagtccggaaatactagga
tatccagaaaaacttgacagattctctctagaaggaaaggcagcctatgctaaagtattc
cacgatttgacagcagtaatagattctttagggttgtgtatatttacaacttttggactt
ggcgtacaggattatgtagatatgtataatgtagttgtaggtggtaagctacatgataca
gaatctataatggaagcaggagatagaatttggacattagaaaagttatttaatttagaa
gctggtatagacagttctcatgatactcttccaaaaagattacttaaagaacctattcca
gagggaccttctaagggatgtgttcataaattaagtgaattacttccagaatactatgca
gtaagaggatgggacaagaatggtatgccaacaaaagatacattgaaaaaattaggcctt
gaagaatatataaagtag

DBGET integrated database retrieval system