KEGG   Clostridium botulinum B1 Okra: CLD_2917Help
Entry
CLD_2917          CDS       T00671                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cbb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CLD_2917 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLD_2917 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CLD_2917 (thrC)
Enzymes [BR:cbb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CLD_2917 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1820920..1822401
Genome map
AA seq 493 aa AA seqDB search
MFYKSTRGEGKNVKASEAIIRGIAEDGGLYVPEELPKIDKSFKELENMDYKELAFYIMKK
YFDDFNEEELKECIDRAYDSKFEDPLIAPLNYKAGAYFLELYHGKTLAFKDMALSILPHL
LKASAKKINITKDIVILTATSGDTGKAALEGFDSVEGTKIVVFYPKDGVSEIQKRQMVTQ
EGKNTFVVGIEGNFDDAQNGVKEIFNDKDFNELLEEKGYMFSSANSINIGRLVPQIVYYV
YSYVNLLKDKKVGEGESINIVVPTGNFGNILAAFYAKNMGIPVGKLICASNENKVLTDFI
NTGIYDRRRKFSVTNSPSMDILISSNLERFLCEISGKDSCLIKNLMAELKEKGKYEITEE
MKKRLDILYGDFSDEDDTLKAIEKVYESSDYLIDTHTAVAYDVYEKYKNKTGDNRVTIIA
STASPFKFPKSINEVLNIGHENASDFELVNLFSDKLNLKLPKGLEGLEEKEICHKVTCKK
DEMKKVIKNFLGI
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
ttgttttataaaagtactagaggagaaggaaagaatgttaaagcatcagaggcaataatt
agaggaatagctgaggatggaggattatatgtaccagaagagcttcctaaaatagataag
agctttaaagaactagaaaacatggattataaagaattagcattttatattatgaaaaag
tactttgatgattttaatgaagaggaacttaaagaatgtatagatagagcctatgacagt
aagtttgaagatcctcttatagcgccattaaattataaagctggagcatattttttagaa
ctttatcatgggaaaacattagcctttaaagatatggccttaagcatacttccacacctt
ttaaaagcttcagcaaaaaagattaatataactaaagacatagttatattaacagctact
tcaggagatactggaaaagctgctttagaaggatttgatagtgtagagggtacaaagata
gtagtattttatcctaaggatggagtaagtgaaattcaaaaaagacaaatggttacacaa
gaggggaaaaatacttttgtagttggtatagaggggaacttcgatgatgctcaaaatgga
gttaaggaaatatttaatgataaagattttaatgaattattagaggaaaagggatatatg
ttttcctctgctaattctataaatataggaagattggtaccgcaaatagtatattatgtt
tattcttatgtaaacctacttaaagacaaaaaagtaggggaaggagaaagtataaacata
gttgttcctacaggaaattttggtaacattttagcagccttttatgctaaaaatatggga
ataccagtgggaaaattaatttgtgcatctaatgagaataaggtgctaacagactttata
aatactggaatatacgataggagaagaaaattttctgttactaattctccttctatggat
attttaatatctagtaacttggaaaggtttttgtgtgaaataagtggaaaagattcatgc
cttataaaaaatctcatggcagaacttaaagaaaagggtaaatatgagataacagaggaa
atgaagaagagattagatatattatatggagatttttcggatgaagatgatacacttaaa
gctattgaaaaagtctatgaaagttctgattatcttatagatactcatactgcagtagct
tatgatgtttatgaaaaatataaaaataaaacaggagataatagggttacgattatagca
tccactgcaagtccattcaaatttcctaaaagtataaatgaagtgttaaatataggacat
gaaaatgcttcagattttgaattagttaatttattttcagacaaattaaatttaaagttg
cctaaaggattagaaggactagaggaaaaagaaatttgtcataaggtcacttgtaaaaag
gatgaaatgaagaaagtaattaaaaattttttaggaatatag

DBGET integrated database retrieval system