KEGG   Clostridium botulinum B1 Okra: CLD_2922Help
Entry
CLD_2922          CDS       T00671                                 

Gene name
acoC
Definition
(GenBank) TPP-dependent acetoin dehydrogenase complex, E2 component, dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
cbb00010  Glycolysis / Gluconeogenesis
cbb00020  Citrate cycle (TCA cycle)
cbb00620  Pyruvate metabolism
cbb01100  Metabolic pathways
cbb01110  Biosynthesis of secondary metabolites
cbb01120  Microbial metabolism in diverse environments
cbb01130  Biosynthesis of antibiotics
cbb01200  Carbon metabolism
Module
cbb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cbb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLD_2922 (acoC)
   00020 Citrate cycle (TCA cycle)
    CLD_2922 (acoC)
   00620 Pyruvate metabolism
    CLD_2922 (acoC)
Enzymes [BR:cbb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CLD_2922 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ACA44828
UniProt: B1ILQ4
Position
1813787..1815097
Genome map
AA seq 436 aa AA seqDB search
MGKLEVMPKLGLTMTEGELVKWHKKEGDTIKVGETLFDVTTDKLTNNVEAKADGIVRKIL
VEEGTVVECLKPVAIIGDKDEDISNLLKESLQDSKENEVEKEVKESKEEIKDNRKIKKGE
RTKISPIAKRLAKENDVDIQLLDGTGPEGRIVLKDVESYIENNKNNIKTSPVAEKMAKDL
GVNLEDIKKDGRIMKDDILEFIQKSTPSVGEDLMDRRVKMSTMRKVIASRMSESSKISPT
VTYDIEVDMTNLKRLKEQIKDEWKVTYTDLLVKIVSKVLIQYPLVNCSIEGDEMIFRNYS
NIGVAVALEEGLVVPVVKYANQKGLKDISIEVKELAHKAKNNGLTEENSTGGTFTITNLG
MFGIKSFSPIINQPEVAILGVNMITNTPVVENGEIVIKPLMSLSLTADHRAVDGAVAAQF
LKAVKKYMEKPELLIL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagttagaggttatgccaaagctgggattaactatgacagagggtgaactagtt
aaatggcataaaaaagaaggagatactataaaggtaggagagaccttatttgatgtaaca
acggataaattgactaataatgtggaagcaaaggctgatggaattgtaagaaagatttta
gtagaggaaggtacagtagttgaatgtttgaaaccagtagccataattggagataaagat
gaggatatatcaaatctattaaaggaatctttacaagatagtaaggaaaatgaagtagaa
aaagaagttaaagaatctaaggaagagataaaagataataggaaaattaaaaaaggagaa
agaacaaagatatccccaatagcaaaaagacttgcaaaggaaaatgatgtggatattcaa
ctattagatggaacagggcctgaaggaagaatagttttaaaagatgtagaatcatatata
gaaaataataagaataatattaaaacttctccagtagcagagaagatggccaaagattta
ggcgttaatttagaagatataaagaaagacggaagaataatgaaagatgatatattagaa
tttatccaaaaatctactccttctgtaggagaagatttgatggatagaagagtaaaaatg
agcactatgagaaaagtaattgcctcaagaatgagcgaaagttcaaagatttctcctaca
gtgacctatgacattgaagtggacatgactaatttaaaaaggttaaaggaacaaattaaa
gatgaatggaaagttacttatacagatttattagtaaaaatagtttctaaagtactcatt
caatatcctttagttaattgctcaatagaaggagatgaaatgatttttagaaattattca
aatattggagtagcagtggctttagaggaaggccttgtggtaccagtggttaaatatgca
aaccaaaagggactaaaggatatttctatagaagtgaaagaattagcccacaaagctaaa
aataatggacttactgaagaaaatagtactggaggaacttttactataactaatcttggt
atgtttggtataaagtctttttctccaattataaatcagcctgaagtagctatattaggt
gtgaatatgataactaatactccagtggtagagaatggagaaatagtgataaaacctctt
atgagtttatctcttactgcagaccatagggcggtagatggtgctgtagcggctcaattc
ttaaaagcagttaaaaaatatatggaaaagccagagttgcttatattatag

DBGET integrated database retrieval system