KEGG   Clostridium botulinum B1 Okra: CLD_2951Help
Entry
CLD_2951          CDS       T00671                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cbb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLD_2951
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLD_2951
   00052 Galactose metabolism
    CLD_2951
   00500 Starch and sucrose metabolism
    CLD_2951
   00520 Amino sugar and nucleotide sugar metabolism
    CLD_2951
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CLD_2951
   00524 Butirosin and neomycin biosynthesis
    CLD_2951
Enzymes [BR:cbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CLD_2951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1776290..1777237
Genome map
AA seq 315 aa AA seqDB search
MNKKYVVGVDLGGTKIYTALVDLDGNIIKEKNVKTEASKGELDVLYKIINTIDNVIEGVN
LEEIKAIGIGSPGPLDAKEGIIISSSNLPFENFSLVQPIKDKYNIPTYLDNDANVATLAE
FMFGEGKGTKNMIYVTASTGIGAGAIINSRIYRGNTGNALEIGHTTVMKDGPNCGCGNKG
CAESLGSGTAIMKKAKEVCKNNGETSLKKYDNLTAKEVFEEAKKGDKVSKEVLEFCLSYL
GITVANIINTFDPEMVVIGGGVINGGEIVCDIINREVKNRCWKAIRDNCKITKAKLAGKA
GVLGAAALAITESKN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaatatgtagtgggtgttgatttagggggaacaaagatttatacagcactt
gtggatttagatggaaatataataaaagaaaaaaatgttaaaactgaagcaagcaaggga
gaacttgatgtattatataaaataataaatactattgataatgttatagaaggggtaaac
ttagaagaaataaaggctataggaataggttcaccaggacctttagatgctaaagaaggt
ataataatttcatcttcaaatctaccctttgaaaattttagcttagttcaacctataaag
gataaatataatattccaacatacctagacaatgatgctaatgtagctactctagctgaa
tttatgtttggtgaaggaaaaggtaccaagaacatgatatacgtaacagcaagtacaggc
attggagcaggagctataataaatagcagaatatatagaggaaatacaggaaatgcttta
gaaataggtcatacaactgttatgaaggatggaccgaactgtggttgtggtaataagggt
tgtgcagaaagtttaggttctggtactgccattatgaaaaaggcaaaagaagtttgtaaa
aataatggagagacatctttaaaaaaatatgataatctaactgcaaaggaagtttttgaa
gaagctaaaaaaggagataaggtttcaaaggaagtactagaattttgcttatcctattta
ggtataactgtagccaatataataaatacctttgatccagaaatggttgtcataggcgga
ggagttataaatggtggagaaattgtttgtgatataataaatagagaagtgaaaaataga
tgctggaaagctattagagataattgtaaaataacaaaagcaaagcttgcaggaaaagcg
ggggttctaggagctgcagccttagctataactgaaagtaaaaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system