KEGG   Clostridium botulinum B1 Okra: CLD_2988Help
Entry
CLD_2988          CDS       T00671                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cbb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CLD_2988 (rbsK)
Enzymes [BR:cbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CLD_2988 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1735643..1736554
Genome map
AA seq 303 aa AA seqDB search
MDIAVIGSNMVDLISYIDRMPKEGETLEAPDFKMGFGGKGANQAVTAARLKSDVMMVSKV
GDDLFGQNTIKNFKNNGINTDFVTVQKNQASGVAPIFVDKESKNSILIIKGANKNLSPTD
IDDASKELKKCSLIILQLEIELETVYYAIDFANKNNIPVLLNPAPATKELDFDYVYKCDF
FVPNETELEILTNKPVNTIGKIKEAAHLIGDKGVKNVIVTMGNRGLLWINKDEEHFIKAR
KVDSVDTTGAGDGFIGCFAHYYVATKNILLALEKATAYAALSVTRYGTQTSYPTKEEFEE
FLK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggatattgcagttattggttcaaatatggtagatttaataagttatattgatagaatg
cctaaagaaggtgagactttagaagcaccagattttaaaatgggatttgggggtaaggga
gcaaaccaggccgttacagctgcaagattaaaatcagatgttatgatggtaagtaaagtt
ggagatgatttatttggacaaaacactattaaaaattttaaaaacaatggtataaataca
gattttgtaactgttcaaaaaaatcaagctagtggagttgcacctatttttgttgataaa
gaatctaaaaatagcattttaattattaaaggtgccaataaaaatttatctcctacagat
atagatgatgcaagtaaagaattgaaaaagtgttctttaattattttacaattggaaatt
gaattagaaactgtttattatgctatagattttgcaaataaaaataatattcctgtattg
ctaaatcctgctcctgctacaaaagagcttgatttcgattatgtttataaatgcgatttc
tttgtgccaaatgaaacagaattagagattttaacaaataaacctgtaaatacaatagga
aagataaaagaagctgctcatttaattggggataaaggtgttaaaaatgtaattgttaca
atgggtaatagaggtttactatggattaataaagatgaagaacattttataaaagcacgt
aaagttgattctgtggataccactggtgctggcgatggatttattggatgttttgcacat
tattatgtagccacaaaaaacatattattagctcttgaaaaagcaacagcttatgcagct
cttagtgttacaagatatggtactcaaacttcttatcctacaaaagaggagtttgaagaa
tttttaaagtaa

DBGET integrated database retrieval system