KEGG   Clostridium botulinum B1 Okra: CLD_2996Help
Entry
CLD_2996          CDS       T00671                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CLD_2996 (folE)
Enzymes [BR:cbb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CLD_2996 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1728105..1728695
Genome map
AA seq 196 aa AA seqDB search
MAIDVKAIEEHIRGILIALGDNPEREGLKNTPKRVAKMYEEVFKGMCYSNDEIAEMFNVT
FEDDLCINDNENDMVFMKEIEIFSHCEHHLALMYNMKVAIAYIPKKKIIGLSKIARIADM
VGRRLQLQERIGSDIAEILQKITDSEDVAVIIEGEHGCMTTRGIKKPGTKTITTTLRGKF
NTDPIVSNKLMMLYTK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcaattgatgttaaagcaattgaagaacacataaggggaattttgatagctttagga
gacaacccagaaagagaaggtctaaagaacacaccaaaacgtgtagctaaaatgtatgaa
gaagtattcaaaggtatgtgttatagcaatgatgaaattgcagaaatgtttaatgtaacc
tttgaagatgatttatgtataaatgataatgaaaatgacatggtttttatgaaggaaata
gaaatatttagtcattgtgaacatcatttagcacttatgtacaatatgaaagtagccata
gcatatatacctaagaaaaaaattattggtttaagcaaaatagcacgaatagcagatatg
gtagggcgtagactacagcttcaagagaggattggaagtgatatagcagaaatacttcag
aagataactgactcagaagatgtagctgttattatagaaggagaacatggctgtatgacc
actagaggaataaagaagccaggtactaaaactataacaactacattaaggggaaagttt
aacacagatcctattgtaagcaataaattaatgatgctttatacgaaataa

DBGET integrated database retrieval system