KEGG   Clostridium botulinum B1 Okra: CLD_3298Help
Entry
CLD_3298          CDS       T00671                                 

Definition
aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbb00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CLD_3298
Enzymes [BR:cbb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     CLD_3298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1401704..1402351
Genome map
AA seq 215 aa AA seqDB search
MNNETYLRLQIVEAGKRLQQRFFVASNDGNISAKLDENTILITPTGVNKGEVTPDQIIKV
DREGNVIEGHMKVTSEIKMHLAVYNMREDVKAIVHAHPPASTAFSVSKEKLDDPVILPEA
VFSLGKIGYCEYGTPSTDEVPKAVEKEIPYSDVLLLSNHGALTVGTDVMQAYYRMENLEM
VSKVTIYSKMIGNIKTLNELQVEKLNKVKEEKGWG
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
ttgaataatgaaacgtatttaaggttacaaattgtagaggcaggaaaaagacttcaacaa
agattttttgtagcttcaaatgatggaaatataagtgctaaacttgatgaaaatactata
ttgattacgcctacaggcgttaacaaaggagaagtaaccccagatcaaataataaaagta
gatagagaaggaaatgttatagaaggtcatatgaaggttacatctgaaataaaaatgcat
ttagctgtttataatatgagagaagatgtaaaagctatagttcatgcccatccaccagca
tccacagctttttcagtatcaaaagaaaaactagatgatcctgttattcttccagaagca
gttttttcattagggaaaataggatattgtgaatatggaactccttctactgatgaggtt
ccaaaagctgtagaaaaagaaattccatatagtgatgtacttttattatctaaccatgga
gctcttacagtaggtacagatgtaatgcaggcttattacagaatggaaaatttagaaatg
gtttcaaaggtaactatttattcaaaaatgataggaaatataaaaactttaaatgaacta
caagttgagaaattaaataaagtaaaagaagaaaaaggttgggggtaa

DBGET integrated database retrieval system