KEGG   Clostridium botulinum B1 Okra: CLD_3298Help
Entry
CLD_3298          CDS       T00671                                 

Definition
aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cbb00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1401704..1402351
Genome map
AA seq 215 aa AA seqDB search
MNNETYLRLQIVEAGKRLQQRFFVASNDGNISAKLDENTILITPTGVNKGEVTPDQIIKV
DREGNVIEGHMKVTSEIKMHLAVYNMREDVKAIVHAHPPASTAFSVSKEKLDDPVILPEA
VFSLGKIGYCEYGTPSTDEVPKAVEKEIPYSDVLLLSNHGALTVGTDVMQAYYRMENLEM
VSKVTIYSKMIGNIKTLNELQVEKLNKVKEEKGWG
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
ttgaataatgaaacgtatttaaggttacaaattgtagaggcaggaaaaagacttcaacaa
agattttttgtagcttcaaatgatggaaatataagtgctaaacttgatgaaaatactata
ttgattacgcctacaggcgttaacaaaggagaagtaaccccagatcaaataataaaagta
gatagagaaggaaatgttatagaaggtcatatgaaggttacatctgaaataaaaatgcat
ttagctgtttataatatgagagaagatgtaaaagctatagttcatgcccatccaccagca
tccacagctttttcagtatcaaaagaaaaactagatgatcctgttattcttccagaagca
gttttttcattagggaaaataggatattgtgaatatggaactccttctactgatgaggtt
ccaaaagctgtagaaaaagaaattccatatagtgatgtacttttattatctaaccatgga
gctcttacagtaggtacagatgtaatgcaggcttattacagaatggaaaatttagaaatg
gtttcaaaggtaactatttattcaaaaatgataggaaatataaaaactttaaatgaacta
caagttgagaaattaaataaagtaaaagaagaaaaaggttgggggtaa

DBGET integrated database retrieval system